tg0320

Coordinates:303781-304692

>tg0320 D-3-phosphoglycerate dehydrogenase, putative (serA)
MKVLVAAPLHEKALEVLKKAGFEILYEEYPDEERLVELVRDVDAIIVRSKPKVTRRVIENAPKLKVIGRAGVGLDNIDLE
AAKERGIKVVNSPGASSRSVAELVFGLLFAVARKVAFADRKMREGVWAKKQCMGIELEGKTIGIIGFGRIGYQVAKIAKA
FEMNVLLYDPYPNEERAKEVGGRFTSLEELLRESDVVTLHVPLIDATYHLINEERLKLMKKTAILINAARGAVVDTEALV
KALQEGWIYGAGLDVFEEEPLSKDHPLTKLDNVVLTPHIGASTEEAQMRAGVQVAEQIVEILKG

>tg0320 D-3-phosphoglycerate dehydrogenase, putative (serA)
atgaaagttctcgttgcggcgccgctgcatgagaaagccctggaggttttgaaaaaggccggttttgagattctctacga
ggagtatcccgacgaggagaggctcgttgagctcgtccgcgatgttgacgcgattatagtaaggagcaagccgaaggtga
cgagaagggtcatcgagaacgctcccaagctcaaggtcattggaagggccggtgttggcctcgacaacatagacctcgag
gccgcgaaggagaggggcattaaggtcgtcaacagcccgggagcgagctcaaggagcgttgcggagctcgtcttcggcct
gctcttcgcggtggccagaaaggtggccttcgccgacaggaagatgagggaaggcgtctgggccaagaagcagtgcatgg
gaatcgagctcgagggcaagaccatcggaatcatcggcttcggaaggatagggtaccaggtggcaaagatagcgaaggcc
tttgaaatgaacgtactcctttacgatccgtatcctaacgaagaacgtgcaaaggaggtcggcggaaggttcaccagcct
ggaagagctcctcagggagagcgacgtggtaacgctccacgttccgctcatcgatgccacctaccacctcatcaacgagg
aacgccttaagctcatgaagaagaccgcgatactcataaacgccgcccgcggagcggtcgtcgacacggaagcactcgtt
aaggcccttcaggagggctggatttacggagcgggcctcgacgtcttcgaggaggagccgctttcgaaggatcacccgct
cacgaagctcgacaacgtggttctaacgccgcacatcggagcatccaccgaggaggcccagatgcgcgctggcgttcagg
tcgcggagcagatagtcgagattttgaagggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 303281 - 305192 (Additional range around tg0320 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCGAGCTCGAAACCAAGGCGGACAAGCTGAGGAGGAGCATAGAGATGATGCTCTATGAGGGAGCCTTTCTGCCTGCCAA CAGGGGAGACTACGTCAGGCTGAGCGAGCTTGTCGACCAGGTCGCCGATGCGGCCGAGAGCGCTGCCCACACGATAATAC TGGCAAAACCCCGCGTTCCCGGTGAACTCTCCGGAGAGTTTTTAGCCCTCGTCGATTCCGGCATAGACACCTATGAGAAG CTCATGAAGGCTGTTAAAGCCCTCAACACCGACGTTGACAGGGCGATGGACCTGGCGAAACAGGTTGAGGACGCGGAGGA AAAGGCCGATGAGATCGAGTACAACCTTAAGAAGCACGTGTTTGAAAGCGAGGAAATAACCACCTACGCAAAGATAATAT GGAACCAGATCATAACGAAGATCGGTGATATAGCGGATCGTGCCGAGGACGCATCCGATCAGGTCCTGCTCATGTCAGTA AAAAGGAGGGGGTGAATAA atgaaagttctcgttgcggcgccgctgcatgagaaagccctggaggttttgaaaaaggcc ggttttgagattctctacgaggagtatcccgacgaggagaggctcgttgagctcgtccgcgatgttgacgcgattatagt aaggagcaagccgaaggtgacgagaagggtcatcgagaacgctcccaagctcaaggtcattggaagggccggtgttggcc tcgacaacatagacctcgaggccgcgaaggagaggggcattaaggtcgtcaacagcccgggagcgagctcaaggagcgtt gcggagctcgtcttcggcctgctcttcgcggtggccagaaaggtggccttcgccgacaggaagatgagggaaggcgtctg ggccaagaagcagtgcatgggaatcgagctcgagggcaagaccatcggaatcatcggcttcggaaggatagggtaccagg tggcaaagatagcgaaggcctttgaaatgaacgtactcctttacgatccgtatcctaacgaagaacgtgcaaaggaggtc ggcggaaggttcaccagcctggaagagctcctcagggagagcgacgtggtaacgctccacgttccgctcatcgatgccac ctaccacctcatcaacgaggaacgccttaagctcatgaagaagaccgcgatactcataaacgccgcccgcggagcggtcg tcgacacggaagcactcgttaaggcccttcaggagggctggatttacggagcgggcctcgacgtcttcgaggaggagccg ctttcgaaggatcacccgctcacgaagctcgacaacgtggttctaacgccgcacatcggagcatccaccgaggaggccca gatgcgcgctggcgttcaggtcgcggagcagatagtcgagattttgaagggc TGAGGCCCTTTCCCTTCTTACTTCTGA CGCCCGCTGAACCAGGTTCGGTGTTCTCGGGGCAGATACTACCAGTATAGTTGTGATAGTCTGGGCGAAATGTTTACCAG TATAATGGTAGAGTTTTGGCTGAAAGTTTACCAGCATAGCGATGAACTTTGGGGAGTTCTTATGGCATTCTCGCGTCAAT CTTTTTAACTCCCACGCCCAGCTTAAACAGGTGAGTGCCTATTGATAGAGGCAATCGTCGAGGCGATAAGGCTCGCGGTG ACAAGGATTCCAGACGACGTCGTTTCCGCTTTGAGAGAAGCCTACGAGCGCGAGGACAACGGGGTAGCGCGCTTCAACCT TGAGAACATCCTGAGGGCGGTAGAGATTGGCAGAACCGAGTCCATACCCGTCTGCCAGGACACGGGAACGCTCACCTTCT TCGTGAGGGCGGGAGTTGGTAGCCCTTTCCTTGGCGAGCTGAGGGGATGGTTAATCGAGGCAACGAGGCTCGC