tg0323

Coordinates:306284-306835

>tg0323 hypothetical protein TGAM_0323
MRNRNELIPFAAGIVLAAYLVQRVPTEAVKYLVPYALLLIPGIKRKSLPFAASSLFALAFLEWLLVHDYIAIIVMGMALL
ETPIRMGKQPVKLWERVINVIVAGAVAYVSVISPETAFKIVGVLTAIGLLSSNRSISGGALVTASAFFVGIALSGTSDMN
PDLFIGVGALLLLYSLNHLRKLLR

>tg0323 hypothetical protein TGAM_0323
atgaggaatagaaacgagctcatccccttcgcggccggcatagtgctcgccgcgtacctcgttcaacgtgttcccacaga
ggccgtgaagtacctcgttccctatgccctcctgctcatcccaggaataaagagaaaaagccttcccttcgcggcttcgt
cgctcttcgcactggcctttctcgagtggctcctagttcacgattacattgcaatcatcgtcatgggaatggcccttctt
gaaactcccatcaggatgggaaaacagcccgtaaagctctgggaaagggttatcaacgtgattgtagcgggtgcagtggc
atacgtttccgtgatttcaccggagacggccttcaagatcgtgggggtgctaacggcaatcggactcctctcgagcaaca
ggtcgatctcagggggtgcgctcgttactgcctcggcgtttttcgtaggaatagcacttagcggaacgagcgacatgaac
ccagaccttttcataggagtgggagcgctgctgcttctttattcgctcaaccatctgaggaaacttctgagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 305784 - 307335 (Additional range around tg0323 is :500nt.)

>Thermococcus gammatolerans EJ3 TAGAGTATAACCGCAACCGCCTGAGCTAAATTCATGACGGGATAATCCTCGCTCGTCGGAATCGTGACGATTAGGTCGAG CCTCTCAAGCTCCTCGTTCTTAAGCCCTATGCTCTCCCGGCCGAAGAACAGACCGACCTCGCCGGTGTAGCCCTTCAGGG TTTCCCTCAGCTCCCAGGGATAAAGCGGTGCGCGGTAGGATATGAACCTCCTTCCGGGCTTTCCGGTGGTTCCAACGGTC AAATCGAACAGTTCTAAAGCTTCCTCGAAGGTTTCCACGATGGTTGCGTTCTTGAGAACATCCCTTGCGTGGACCGCATA GCTGTAGCTCTCCTCGCTTAAGTTAGGGTTCACGAGGACTAACCTGGAGAAGCCGAAGTTCTTCATCGTCCGCGCCACCA TACCTATGTTCGCAGGCCCCTCTGGCTCGACGAGAACGACACTCGGCATCATAACGAAAGGGTTTAAAGAGAGGTGCATT AAAGGCTTCCGGTGAGAGA atgaggaatagaaacgagctcatccccttcgcggccggcatagtgctcgccgcgtacctc gttcaacgtgttcccacagaggccgtgaagtacctcgttccctatgccctcctgctcatcccaggaataaagagaaaaag ccttcccttcgcggcttcgtcgctcttcgcactggcctttctcgagtggctcctagttcacgattacattgcaatcatcg tcatgggaatggcccttcttgaaactcccatcaggatgggaaaacagcccgtaaagctctgggaaagggttatcaacgtg attgtagcgggtgcagtggcatacgtttccgtgatttcaccggagacggccttcaagatcgtgggggtgctaacggcaat cggactcctctcgagcaacaggtcgatctcagggggtgcgctcgttactgcctcggcgtttttcgtaggaatagcactta gcggaacgagcgacatgaacccagaccttttcataggagtgggagcgctgctgcttctttattcgctcaaccatctgagg aaacttctgagg TGAGATCATGAGGATTTACGTACTCGGAGCGGGAAGCATAGGCTCCCTCCTCGGCGCGCTTTTAGCT AAAGCCGGAAACGACGTCCTGCTCATCGGGAGGGAAGAGCAGGTAAGAGCTGTGAACGAGAGGAGATTGAAAGTTATCGG CGTTGAAGAGTTTGAGGTGAAGGTTAACGCCTCCCTCCACGCACCGGACGAGCCACCTGAGCTTCTCCTCCTCACGACGA AGTCCTACTCAACGAAGACCGCCTTAGAGTGCGCGAGGAACTGCATAGGGCCAGAGACATGGGTTCTAAGCGTTCAAAAC GGCCTCGGAAACGAAGATCTCGCGATGAAGTACACGGACAGGGTAATCGGCGGGATAACCACCAACGGCGCGATGCTCGT CGAGTGGGGGGTTGTCAGGTGGACGGGGAAGGGAATAACGGTCATCGGAAAGTACCCGACCGGAAAGGCCGAGTTTGTTG AAAGGGTCGCGAGGGTCTTCAATGAGGCAGGAA