tg0337

Coordinates:321125-321982

>tg0337 Drug/Metabolite transporter, putative
MKRGYILVFLAASTWGTIGIFATYIYRYKVDPFTMVFWRVLFALVILGTYVSLFLRENPFIREKLWFYAVYGLVGVFAFY
TLYFYTVKISSVGFAVLLIYTAPAFSVILGRLIFREPITAEKITALVMVLVGVILVAGNVDFKVSNVALLTGIATGFTYA
LYGVLAKFGVRNERPERVLFMTLLFGLLFLAPFSKFSVPTGAIPYLLGLAFFPTFLGYTLYNHALKEVEVSRASIVATVE
PVVAIVLAYLLFGEKLTPLQLLGGTLIIGASVLVHLREGRNGRAQM

>tg0337 Drug/Metabolite transporter, putative
atgaagcgcggctacattctcgtttttctcgccgcctcaacctggggaacgataggtatattcgccacttacatctaccg
ctacaaggttgatccctttacgatggtcttctggcgcgtcctctttgcgctggtaatcctcggcacttacgtgtccctct
tcctccgcgaaaatcccttcatccgcgagaagttgtggttctacgcggtttatggcctagttggggtcttcgccttttac
accctctacttctacaccgtcaaaatctcctctgtcggcttcgcggttctgctcatttacaccgccccggccttctcggt
aatcctcggcaggctgatcttcagggaacctataactgctgagaagataaccgctctggtaatggttttggtgggggtca
tcctagttgcgggaaacgtggacttcaaggtgagcaacgttgcactccttacgggaatagcgacgggcttcacctacgct
ctctatggagtcctggccaagttcggtgtcagaaacgagaggcccgagagggttctcttcatgaccctgctctttggcct
gctcttcctagcccccttttcgaagttctccgttccgacaggtgctattccctacctcctcggtctggccttcttcccga
ctttccttggttacaccctttacaaccacgccctcaaggaagtcgaggtcagcagggccagtatagtggcgaccgttgag
ccggtggtggcgatagtcctcgcgtaccttctctttggagagaagcttaccccactccagctccttggtgggactctcat
aataggggcctcggtcctcgtgcacttgagggaagggaggaacgggagggctcagatg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 320625 - 322482 (Additional range around tg0337 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCTTCTTCACTTTTTATCGGTGGTCAAAATGGTTCTCGAACCCCTGAGGCTAGCTTTTAGGTACCCTCACATCAAGGTG GGCTTTACCTTCCTCTTTCTAGCGCTTATTATAGCCCTTGCGGGGACCTATGGCGTTGATAAAAGCTACCACGAGAGCGG AACGCTTAAACCTGGACTGAACGTGCTGGGCAACAGCAATTTTGAACGGGACTATTACTACTACAACCGAACTCTCGTGC TTAAATCAAAGTACGGCGAGGTTAAGGTCAACAACATCACCTATCAGGTGTACGATACCCTTAACCTGACCCTGAACTCG CGGCCTCACGTTGAGCTTATTTCAGGGAACGTCAGTTATGATTACACTTCCCGGGCCGTTGACTACCCATTTGCACCTGC ATCACTGATAGCCTTTGTGTTCTTCTTGACAGGACTGGTGCTCTCAGTGCTCGGTTACATGAGGATGATGAGCGACCTTA GATCCGGGTGAGGTGAGCCG atgaagcgcggctacattctcgtttttctcgccgcctcaacctggggaacgataggtat attcgccacttacatctaccgctacaaggttgatccctttacgatggtcttctggcgcgtcctctttgcgctggtaatcc tcggcacttacgtgtccctcttcctccgcgaaaatcccttcatccgcgagaagttgtggttctacgcggtttatggccta gttggggtcttcgccttttacaccctctacttctacaccgtcaaaatctcctctgtcggcttcgcggttctgctcattta caccgccccggccttctcggtaatcctcggcaggctgatcttcagggaacctataactgctgagaagataaccgctctgg taatggttttggtgggggtcatcctagttgcgggaaacgtggacttcaaggtgagcaacgttgcactccttacgggaata gcgacgggcttcacctacgctctctatggagtcctggccaagttcggtgtcagaaacgagaggcccgagagggttctctt catgaccctgctctttggcctgctcttcctagcccccttttcgaagttctccgttccgacaggtgctattccctacctcc tcggtctggccttcttcccgactttccttggttacaccctttacaaccacgccctcaaggaagtcgaggtcagcagggcc agtatagtggcgaccgttgagccggtggtggcgatagtcctcgcgtaccttctctttggagagaagcttaccccactcca gctccttggtgggactctcataataggggcctcggtcctcgtgcacttgagggaagggaggaacgggagggctcagatg TAAAAGTATCTCTCCAGCTCCCACTCGGTGACCTTCTTAGTCTCCAGTGGAAGCTCCCTGCTTTCAATGTATGCAACGTA TTCACTCCACTCCCTCTCTTTGTAGGCTATGAAGTTCTCGTATGCCCCGGCCAGCGCTTCCTTGATTATTTTGTCCCTTC TGAGCTCTTCTAAAGCTTCTCCGAGGCTTCCTGGCAGGGTCTCGATTCCAGCTTTGTTCCTCTCCTCTTCGCTCATTTCG TAAACGTTGGTCTCGACGTATGCCTCTGGCTCGAGCTTCCTCTTGATTCCATCAAGGCCTGCTATGAGTACGGCGGCTAT GGCCAGATATGGGTTGGCACTCGGGTCGGGACAGCGGTACTCTATCCTGGCCCCGTTTCCAGAAAAGGCCGGGACGCGAA TTAGTGTGCTCCTGTTCTTGTAACCCCAGCTGATGTAAACCGGTGCTTCATAGCCTGGAACGAGGCGCTTGTAGCTGTTT ACGGTTGGATTGGTCAGCG