tg0339

Coordinates:323536-323937

>tg0339 hypothetical protein TGAM_0339
MPTAEEILQKEIFRVNLHLPRRRVALGELLNMKDPRVTLRDGSDHHFKRDELLYLASLLGDESRLLKLPIILEISTLNRG
YFRVRGRLEVRVIDEILGEYDPLNEKTEALYPRYLLPRIRRRLPTTTTYAFISE

>tg0339 hypothetical protein TGAM_0339
atgccgaccgccgaggagatactccagaaggagatattcagggttaaccttcacctgccgcggaggagggttgcccttgg
ggagctcctcaatatgaaggatccaagggtaaccctgagggatggaagcgatcatcacttcaagagggacgagctcttgt
accttgcctccctcctgggagatgagtcaagacttcttaagctcccgataatccttgagataagcacccttaaccggggc
tacttccgtgtcagggggagattggaggtcagggtaatagatgagatccttggtgagtacgatcccctgaacgagaagac
cgaggccctgtatcccagatacctcctgccccggatcagaaggcgtctcccaaccacgacaacgtatgcgtttatatcgg
ag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 323036 - 324437 (Additional range around tg0339 is :500nt.)

>Thermococcus gammatolerans EJ3 TAGCCGTAGACCCTCGCTATACCCTCCCAGGGAACTTCAGCGTAGGTGCTTGGATCGGCTTTGAAAAGGAGGTCACTGTC CTCTATCCCCTGAAACCCAGCAATCGAGGAGCCATCGAAGGCTATGCCCTCCTCGATTGCCTCCTCGTATCTTGTTATCG GGATCTCCATCCCCTTTGGAATGCCGTTTATGTCCACGAAAACCAGTTGGATGAAGTGTGGCCTCGGTCTCTCCATCGGG AGTGCCCCAGTGGTTCCCCTGAGGCCCTTTATTTCGTTCATTTTTGCACCACCTTTATGAATGTATGTTCATTATCATGA CGCATTTTCTGAAAGATATGACCTATTTAACCTTTTTGAATGAATTTTTGTCAGAACGGCAAAATTCTGGGGCAGGAACA GGTTTTGAGTTAAATTTGTTTATCAATATCATCTTTATGTCAAAAATAGACATTTTTGTGTTTACCAAAGTTTTTCAGTT AAAGGCCCCTCTATATCACC atgccgaccgccgaggagatactccagaaggagatattcagggttaaccttcacctgcc gcggaggagggttgcccttggggagctcctcaatatgaaggatccaagggtaaccctgagggatggaagcgatcatcact tcaagagggacgagctcttgtaccttgcctccctcctgggagatgagtcaagacttcttaagctcccgataatccttgag ataagcacccttaaccggggctacttccgtgtcagggggagattggaggtcagggtaatagatgagatccttggtgagta cgatcccctgaacgagaagaccgaggccctgtatcccagatacctcctgccccggatcagaaggcgtctcccaaccacga caacgtatgcgtttatatcggag TGATGGAGATGGACGAAAACACGAGGATCCTGAGGGATTACTACTTCTTCACGATA CCCCATATAACCGTTTTTGCGGGGGCTGTGCTGGGCATCCTGTTCATCCTGAGGATAGACGTCCGGATGGCACTGGGGAT CTTTGCCTTTCTCTATGGGCTCATGCTCCTTACCATCCATGCCATTGTTTTTCGGCACTTTCGCTCCAACATGATATACC GGCTGGGACTTCTTTTCTCCCTCGTTCTGGTCATGACAGGCCTCTTTTTAATGTACGCAAGTATCTCAAACCTTTAGGGA TTATTCTAAACCCTCGAAATATTTTTAAGTCGGGCCGCTCCTATCATATCAGTCTCGAAGGTGGTGATGGCTATGCGTTC GCTCGGGTTTTTAACTTTGATCGTGCTCTTTACGGCGCTATTCTCCCTTCCACCGGTTTCATCCAGCGATAATCCCTCCC TGACTACGAGGGATGTAATAACGGTTCTCTCGGGGGAGTTCTT