tg0340

Coordinates:323946-324227

>tg0340 hypothetical protein TGAM_0340
MDENTRILRDYYFFTIPHITVFAGAVLGILFILRIDVRMALGIFAFLYGLMLLTIHAIVFRHFRSNMIYRLGLLFSLVLV
MTGLFLMYASISNL

>tg0340 hypothetical protein TGAM_0340
atggacgaaaacacgaggatcctgagggattactacttcttcacgataccccatataaccgtttttgcgggggctgtgct
gggcatcctgttcatcctgaggatagacgtccggatggcactggggatctttgcctttctctatgggctcatgctcctta
ccatccatgccattgtttttcggcactttcgctccaacatgatataccggctgggacttcttttctccctcgttctggtc
atgacaggcctctttttaatgtacgcaagtatctcaaacctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 323446 - 324727 (Additional range around tg0340 is :500nt.)

>Thermococcus gammatolerans EJ3 TAAATTTGTTTATCAATATCATCTTTATGTCAAAAATAGACATTTTTGTGTTTACCAAAGTTTTTCAGTTAAAGGCCCCT CTATATCACCATGCCGACCGCCGAGGAGATACTCCAGAAGGAGATATTCAGGGTTAACCTTCACCTGCCGCGGAGGAGGG TTGCCCTTGGGGAGCTCCTCAATATGAAGGATCCAAGGGTAACCCTGAGGGATGGAAGCGATCATCACTTCAAGAGGGAC GAGCTCTTGTACCTTGCCTCCCTCCTGGGAGATGAGTCAAGACTTCTTAAGCTCCCGATAATCCTTGAGATAAGCACCCT TAACCGGGGCTACTTCCGTGTCAGGGGGAGATTGGAGGTCAGGGTAATAGATGAGATCCTTGGTGAGTACGATCCCCTGA ACGAGAAGACCGAGGCCCTGTATCCCAGATACCTCCTGCCCCGGATCAGAAGGCGTCTCCCAACCACGACAACGTATGCG TTTATATCGGAGTGATGGAG atggacgaaaacacgaggatcctgagggattactacttcttcacgataccccatataac cgtttttgcgggggctgtgctgggcatcctgttcatcctgaggatagacgtccggatggcactggggatctttgcctttc tctatgggctcatgctccttaccatccatgccattgtttttcggcactttcgctccaacatgatataccggctgggactt cttttctccctcgttctggtcatgacaggcctctttttaatgtacgcaagtatctcaaacctt TAGGGATTATTCTAAA CCCTCGAAATATTTTTAAGTCGGGCCGCTCCTATCATATCAGTCTCGAAGGTGGTGATGGCTATGCGTTCGCTCGGGTTT TTAACTTTGATCGTGCTCTTTACGGCGCTATTCTCCCTTCCACCGGTTTCATCCAGCGATAATCCCTCCCTGACTACGAG GGATGTAATAACGGTTCTCTCGGGGGAGTTCTTATCCGATTCGATTGAAGTTATCAACGAAGCCCCCTTCAACTTCACAG CCGTGGTTTACATCGAATACACCGTCTCGGGCCGTCCGAAGGATCTGATAAACTTCACCCCAATCTACACTGTCTTTAAG AACTGGAAATCCGGCGAATCCCAGGAGCTTCCCTTCAACATTTCCGTTTCCTCAAACGTTGCTCCCGGATTTTACAGCCT GATTCTCCACTTCAGGGGCATGGCTGAGGACGGTTCCCTCCACGATCTCATCCTTAAGGTGCCCCTTCGTGTCAGTGACA ACC