tg0348

Coordinates:330706-331290

>tg0348 hypothetical protein TGAM_0348
MIRKVKPEIRVVGFDDGTFSFSSKVAHGRTILVGVVMKGAREVVGVLSRWITVDGTDATEKLIDAVVNSRFKDLRVIMLK
GVTYGGFNIVDLDKLYLETGLPVLVVIRKKPDLRAMEAALRKHFPDWRERFEVLRRAPPLFELIPGKLYLQTVGLSPETA
AEIVRTTTKTGLIPEPLRLAHMIASAVMTGESTKE

>tg0348 hypothetical protein TGAM_0348
atgatccggaaagtcaaacccgagatacgcgtcgttggcttcgatgacgggactttctccttttcttcaaaggttgccca
cgggaggacgatcctcgtaggagtcgtgatgaagggggctagggaagtcgtcggggttctgagcaggtggataacggtcg
atggaacagacgccaccgagaagctgatcgacgccgttgtgaactcccgcttcaaggatctgagggtgattatgctcaag
ggggtcacctacgggggtttcaacatcgttgacctcgataaactctacctcgagacgggccttcccgtactcgtcgtcat
caggaagaaacccgatctgagggccatggaggcagctctcagaaagcatttcccggactggagggagagatttgaagtcc
tcaggagggcacccccgctcttcgagctcatccccggaaagctctaccttcagaccgttgggctctcccccgaaactgcg
gccgagatcgtgagaacgacgacgaagaccggtttgataccggaacctctgaggctggcccatatgatagcctcggccgt
tatgacgggtgaaagcacgaaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 330206 - 331790 (Additional range around tg0348 is :500nt.)

>Thermococcus gammatolerans EJ3 GCAGGTTCCTCACCCATCCTGCTAAGCCGAGCTTTCTGGCCTCCCTCTGCATACTCCAGCGGAAGCCCACACCCTGAACG CGTCCGTATATTCTTAGGTGCGCCCTAACCTTCCTCATGCACCATCCCGGGGGGATTTCTCCACAAGGGATTTAAGCTTT ACCCGCTTACATACTTCCGGGGGTGTCTCATGGAGGCGATATTCGTCTACACGACGTTTCCTGACTGGGAGAGTGCCAAA AGAATCACCAGGGAGCTGCTTGAGAGAAAGTTGATCGTCTGCGCAAACCTCAGGGAACACCACTCCATGTACTTTTGGGA GGGGAAGATCGAGGAAGGCACTGAGATCGGGGCGATCCTTAAAACTGATGTGAGCAAGTGGAAGGAACTCAAAAACACGC TCAGGGAGCTCCACCCCTACGAGATCCCTATGATAGCGAGGATCGATCTCGATAAGCTCAACAGAGAGTACTCAGAATGG ATGGAGAAGGTGCTCTTTGG atgatccggaaagtcaaacccgagatacgcgtcgttggcttcgatgacgggactttctc cttttcttcaaaggttgcccacgggaggacgatcctcgtaggagtcgtgatgaagggggctagggaagtcgtcggggttc tgagcaggtggataacggtcgatggaacagacgccaccgagaagctgatcgacgccgttgtgaactcccgcttcaaggat ctgagggtgattatgctcaagggggtcacctacgggggtttcaacatcgttgacctcgataaactctacctcgagacggg ccttcccgtactcgtcgtcatcaggaagaaacccgatctgagggccatggaggcagctctcagaaagcatttcccggact ggagggagagatttgaagtcctcaggagggcacccccgctcttcgagctcatccccggaaagctctaccttcagaccgtt gggctctcccccgaaactgcggccgagatcgtgagaacgacgacgaagaccggtttgataccggaacctctgaggctggc ccatatgatagcctcggccgttatgacgggtgaaagcacgaaggag TAGGTTTATAAGGCAGGAAAAAGAGGAAGCAAC GACCGATGATGGCAACAGGGTAGCTACCGAGCGATGAGGAAGCCGTTCCAGTCTGAGGTCAATCACATGGAACGAGAAGG ACAGGGATCTTTGAGTCCCGCATGACCCTCTCCGCTGTGCTACCGAGGATCAAATCCTTGAGGAAGCTCCTGCCCTTCTT GCCTATTACGATAATGGTTGCTTTCTTGGCCAGGGCGGTTCCTATTATGGCCTGACTCGCGGTCCCCACCATCACTTCAA GCTCGAATTCGGCTTTAATTCCCTTTGCAGTCTTCTCAAGGTTCTTTCTGGCTATCTCGATGTTGTGCTCGAGTTCGTCT ATGCCCCCGTAGTCCACAGAGTGGAGAAGTATTCCCGACTCTATCAGCTCTTCGAACTTCTTCACCGTCTTCACGATCCT GATTGAACATTTTGAGAAATCCAGGGCAACGAGGGGCCTGCTGAAGATCCCCGAGCACGATGGAAA