tg0351

Coordinates:333558-334376

>tg0351 Permease, outative
MSRKHEIGAVLLWSTVASAFKLSLRYMSPIQLLFWAFLTSFLLYGVLHLRSFRFSRENLRSAYLGFALLLYYTVLFSAYD
LLPAQEAQALNYTWPLALVLLSVPLLERKLAPDTLLGLFLGFLGALIVATRGRPLSLGFSNPVGDILGLGSALIWAIYWL
LNVRDERKLEEKMFWNFTFALLYSVPLMLFAGFSLPSPKGLAGAVYVGLFEMGVTYLLWYRAVESDVAFASNLVYLVPFL
SLLFISIVLGEMIETTTVLGLVLIVVGILLGQR

>tg0351 Permease, outative
atgtccaggaaacacgagattggagccgttctcctctggtcaaccgttgcttcggccttcaagctttcactacggtacat
gagtcccatacagcttctcttctgggctttcctgacgtcgttcctcctctatggagtcctccatctccggagctttaggt
tctccagagaaaacctccgctcggcttacctcggttttgctcttctcctctactacaccgttctcttctcggcttacgac
cttctgccggctcaggaggcgcaggcgctcaactacacgtggcctctggcactcgttcttttgtctgtgcccctgttgga
aagaaaacttgccccggacaccttattgggccttttccttggatttctaggcgcccttatcgtcgctaccaggggcagac
ctctttccctcggcttctcaaatccagttggagacatcctcggtcttggaagcgctttaatctgggccatatactggctt
ctgaacgtcagggacgagaggaagcttgaggagaagatgttctggaacttcacctttgccctcctttactctgtcccgct
gatgctctttgcgggcttttctctgccttccccgaagggtctcgccggtgcggtttacgttggcctctttgaaatgggcg
ttacttacctcctctggtacagggctgttgagagcgacgttgcctttgcctcgaaccttgtatacttggttccgttcctg
agtctgctttttatttccatagtcttgggtgagatgatagaaactacaacggttctcggtttggttttgatagtggtggg
aatccttctcgggcagaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 333058 - 334876 (Additional range around tg0351 is :500nt.)

>Thermococcus gammatolerans EJ3 GGACTAGGTGCTCGCGATACTCTCAGGCTTGAGGCTGGCTACACCCTCTACGGCAACGAGACGAAAGAGTTACAGCTCCT CAGCACCGACATCGACGAGGTTACCCCGCTCCAGGCCAACCTCGACTTCGCCATCTTCTGGGACAAGGAGTTCATCGGTA AGGAGGCACTCCTCAAGCAGAAGGAAAGGGGCTTGGGCAGGAAGATGGTACACTTCAAGATGGTTGATAGGGGAATCCCA AGGGAGGGCTACAAGGTTCTTGCCAACGGAGAGGTGATCGGTGAGGTCACGAGCGGAACACTCTCGCCTCTCCTCGGAAT CGGTATCGGAATAGCTTTCGTCAAGGAGGAATACGCCAAGCCAGGCCTCGAAATCGAGGTGGAAATCAGGGGCAAGCCCA AGAGGGCCGTAACAGTTTCCCCGCCGTTCTACGACCCCAAGAAGTATGGTGCCTTCAGGGAGGAGTGAAGTTTTTATTCC ATCTCTCCCTATTCTTTCCT atgtccaggaaacacgagattggagccgttctcctctggtcaaccgttgcttcggcctt caagctttcactacggtacatgagtcccatacagcttctcttctgggctttcctgacgtcgttcctcctctatggagtcc tccatctccggagctttaggttctccagagaaaacctccgctcggcttacctcggttttgctcttctcctctactacacc gttctcttctcggcttacgaccttctgccggctcaggaggcgcaggcgctcaactacacgtggcctctggcactcgttct tttgtctgtgcccctgttggaaagaaaacttgccccggacaccttattgggccttttccttggatttctaggcgccctta tcgtcgctaccaggggcagacctctttccctcggcttctcaaatccagttggagacatcctcggtcttggaagcgcttta atctgggccatatactggcttctgaacgtcagggacgagaggaagcttgaggagaagatgttctggaacttcacctttgc cctcctttactctgtcccgctgatgctctttgcgggcttttctctgccttccccgaagggtctcgccggtgcggtttacg ttggcctctttgaaatgggcgttacttacctcctctggtacagggctgttgagagcgacgttgcctttgcctcgaacctt gtatacttggttccgttcctgagtctgctttttatttccatagtcttgggtgagatgatagaaactacaacggttctcgg tttggttttgatagtggtgggaatccttctcgggcagaga TGAGCGTTGACCTCTCAACAAAGCTATTTGAAACGCTCT CTCAATGGGGCAGCTAATTGAGAGTTCATGCCAAAATTTGCAATTTTTAGAGGGACATTTTATTCTTCCGCCGGAGCTTC CATCAGAAAGGGCTGTGATGGTGCGGTGGCCGGGATTTGAACCCGGGTCACCGGCTTGGAAGGCCGGTGTCCTAGACCAG GCTAGACTACCACCGCGCAGAAAGTGGTGGGGCGAGGGGGATTTGAACCCCCGACACCCGGATCTTCAGTCCGGCGCTCT CCCAGGCTGAGCTACCGCCCCACGCCCAAAGATAAGAGCTTGGAGGGGATTTATAAATCTTGCGGTGGTGAGGTGATGCT ACCCTTCGTTAGAGGACTTAGAGTTTGGGGCCTATTTTTTGAAAAGAACTTTCAGCTCCCTTTTATACATGCCCCAGTTC AGCCCGAAGTGGACTATTATCAGCGCGTTCATCAGCGGCCCTAGGACGTTTCTGATCCTG