tg0352

Coordinates:334770-335081

>tg0352 hypothetical protein TGAM_0352
MNSICSFQTFLWSEVYSQEVKKMNIVKARAILSTLLLVVFLGVLFIMMGVLYTSKTGHSFLGMNKNQLFRIRNVLGPLMN
ALIIVHFGLNWGMYKRELKVLFKK

>tg0352 hypothetical protein TGAM_0352
ttgaacagcatttgttctttccaaacgtttttatggagtgaagtgtattctcaggaggtgaaaaaaatgaacattgtgaa
ggcacgggccattctttcaacgcttctgcttgtggtgttccttggcgttctattcatcatgatgggggtgctctacacca
gcaaaactggtcattcgttccttggtatgaacaagaatcagctcttcaggatcagaaacgtcctagggccgctgatgaac
gcgctgataatagtccacttcgggctgaactggggcatgtataaaagggagctgaaagttcttttcaaaaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 334270 - 335581 (Additional range around tg0352 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGGAACGACGCTCGTTGGAGGAGAGACTCCAAGGGTGAGTGTGAAGGAGCTTGAGGACGAGAACGTTGCCCAGGAAACC GCAAAGAGCGTGTGGGTTCCAGCGAGGAACCTCGTTCTCATAAGCGTTGCCGCTTCTCTCCTCGATGCCCTCGGTGGCGG GGACATAGTAGTCGGCTTCAACGCTGAGGAAGGAGTCACCTTCCCGGATAACACCCCCGAGTTCGTCGAGAAGATGAACG AGGCTCTAAAATACGGGACTATGGCCGAGGTGAAGGTTGTTGCCCCACTCATAGACCTCGACAAGAGGGGCATAGCGCGG CTTTTGAAGGAGCTGAACGCTAAGTACGAGTACTCAAACTCCTGCTACATGCCGAAGGGCTTCACGGAGGACGGGAAACC GATACACTGCGGCCAGTGCGAGAGCTGTGTCAGGAGGCACCGCGGTCTCATTGAGGGCATAGGAGAGGACAGAACCGTTT ACGCCGTCGAGCCGAGGAT ttgaacagcatttgttctttccaaacgtttttatggagtgaagtgtattctcaggaggtg aaaaaaatgaacattgtgaaggcacgggccattctttcaacgcttctgcttgtggtgttccttggcgttctattcatcat gatgggggtgctctacaccagcaaaactggtcattcgttccttggtatgaacaagaatcagctcttcaggatcagaaacg tcctagggccgctgatgaacgcgctgataatagtccacttcgggctgaactggggcatgtataaaagggagctgaaagtt cttttcaaaaaa TAGGCCCCAAACTCTAAGTCCTCTAACGAAGGGTAGCATCACCTCACCACCGCAAGATTTATAAATC CCCTCCAAGCTCTTATCTTTGGGCGTGGGGCGGTAGCTCAGCCTGGGAGAGCGCCGGACTGAAGATCCGGGTGTCGGGGG TTCAAATCCCCCTCGCCCCACCACTTTCTGCGCGGTGGTAGTCTAGCCTGGTCTAGGACACCGGCCTTCCAAGCCGGTGA CCCGGGTTCAAATCCCGGCCACCGCACCATCACAGCCCTTTCTGATGGAAGCTCCGGCGGAAGAATAAAATGTCCCTCTA AAAATTGCAAATTTTGGCATGAACTCTCAATTAGCTGCCCCATTGAGAGAGCGTTTCAAATAGCTTTGTTGAGAGGTCAA CGCTCATCTCTGCCCGAGAAGGATTCCCACCACTATCAAAACCAAACCGAGAACCGTTGTAGTTTCTATCATCTCACCCA AGACTATGGAAATAAAAAGCAGACTCAGGAACG