tg0355

Coordinates:336195-336428

>tg0355 Transcription regulator, SpoVT/AbrB family
MPVTKVTRNYQITIPAEIRKALGIKQGEYLTVELRGDEIVIKRAKRKWKTYRLGRKYSLEEMERMIEESIEEALRWEE

>tg0355 Transcription regulator, SpoVT/AbrB family
atgccggtaacgaaggtgacccgaaactaccagataacgattccggccgagatcaggaaggcccttggcataaagcaggg
tgaatacctcaccgtcgagctgaggggggatgagatagttatcaaaagggcaaagagaaaatggaagacttaccgcctgg
gcagaaagtacagccttgaagagatggaaagaatgattgaggagtccattgaggaggcgttgagatgggaggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 335695 - 336928 (Additional range around tg0355 is :500nt.)

>Thermococcus gammatolerans EJ3 ATAGACGATATTACAAAGCTCGGTCTGGCGGCGGAGAAAGCCGGTGCAGATGCAGTCTCGGCGATAAACACGCTGAAGGC GATAGCCATTGACATCTACGCGAGGAGGCCAATCCTCAGCAACCGCGTCGGTGGATACTCCGGGCCAGGCGTTAAGCCCG TCGCACTCAGAGCGGTTTACGACCTCGCGAAGGTTCTTGACATTCCAGTGATAGGCATCGGCGGGATAACAACGTGGCAG GACGCCGTTGAGTTTCTTCTGGCTGGTGCATCGGCGCTCCAGATTGGGACGGCGGTCTCGCTCAGGGGCTGGAAGGTTTT CAGGGAAATCAACGAGGGCATCAAAGCCTACCTCGAAAGTGAGGGCTTTTCCAGCGTGAGTGAGATAGTTGGCCTCGCCC TTGAGTGAAGTTTTATTTCTGCATTCTGTTTTGTCCCATACTCCTTCTGGCCAGAAGAGCTTTATGGGAGAAAAATCTAC TATACTATGGTGAACTACT atgccggtaacgaaggtgacccgaaactaccagataacgattccggccgagatcaggaag gcccttggcataaagcagggtgaatacctcaccgtcgagctgaggggggatgagatagttatcaaaagggcaaagagaaa atggaagacttaccgcctgggcagaaagtacagccttgaagagatggaaagaatgattgaggagtccattgaggaggcgt tgagatgggaggag TAGCAGTTATCGACACGAACTTTTTCGTTTATGCTCTGTTTGAGGATTATGAGAGACACGAAGAG GCCCTTGACATCTTAATGAACCTTGATAAGTGGGTCGTGCCTACAATAACCCTCTACGAGCTCATTTGGCAACTGGCAAA AATGGGTGTTCCCCCGAATAACGCTGAAGACATGGTCAGACAGATAATTGAAGAACCAAGGGCAGAAATCATCGATGATA GGCTGTATCTACTATCAGCCTTCGAGCTCTACGGAAACCTCGGTCTCAAGCACTACAACGATTCTGTAATCCTCGCTATG GCCAAGGAAGTCGGAACCCTCGCGAGCTACGACAAAAAGCTTAGAAACCGTGCAAGGGAAGTTGGAATTAAACTGCTTCC GGAGGAGTTGGAATGAAGCGCGCGGTGGTGCTGTTTTCGGGAGGGCTTGACAGCACGGCCTGCCTATACTGGGCAAAAAA GCACTACGACGAGGTTATGATGCTCGTCATCAACT