tg0374

Coordinates:355305-355493

>tg0374 Ferredoxin (fdx)
MAWKVSVDVDTCIGDAICASLCPDVFEMGDDGKAHPIVEVTDLECAQEAAEACPVGAITLEEV

>tg0374 Ferredoxin (fdx)
atggcgtggaaggttagtgttgatgtcgacacctgcattggtgatgccatctgtgcaagcctctgcccggacgtcttcga
gatgggagacgacggaaaggctcacccaatcgttgaggttaccgacctcgagtgcgcccaggaggccgctgaggcctgtc
cagtcggcgccataacccttgaagaggtc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 354805 - 355993 (Additional range around tg0374 is :500nt.)

>Thermococcus gammatolerans EJ3 GGAAAACTCGAAGGAATCGGGCTGATAACCATCAACCGTGAGAGGGAAGTGAAGGAAGCTGGAAACGTCAAGATAACCGA GGAGATGATACTTGAGAAGCTCAAGGAGGTCATCGATCCCGAGATTGGAATAGACGTCGTCAACCTCGGCCTCATCTACG AGGTGAAGGTCAACCCCGACAACACCGTTTATGTCAAGATGACGATGACAACTCCGGGCTGTCCGCTCACTATGTGGATT CTCAGGGCCGTTGAGGACAAAATCCTCGAGATTCCGGGCGTTAAAGATGCCGAGATTGAACTCACCTTTGACCCTCCCTG GACGCCCGACAGGATAAGCCCGGAGTACAAGAAGAAACTTGGGCTGTATTGACCAGTTTCGTCTTTTTCTGTTCATTTTA GTCCTTCTTCGGGCGTTGAAAGTTAATTTGTTTCAAACCGTCGGTTTTTGGAACGAAAAGTTTATATTCGTCAAGACGCA CTTATCGGCGGTGATGTCCC atggcgtggaaggttagtgttgatgtcgacacctgcattggtgatgccatctgtgcaag cctctgcccggacgtcttcgagatgggagacgacggaaaggctcacccaatcgttgaggttaccgacctcgagtgcgccc aggaggccgctgaggcctgtccagtcggcgccataacccttgaagaggtc TGAGGGCCTTTTCTTTTTGATTCCTAGTA TTTTTAAATGACGAGCCCTGATGGAGTGTTCAAGTGAAGAGTAGCAGTAGCGGGCTCAGAATACTAAAGCCCTTCCTGAT GAAGCAGGGTATTAGTAAGTATTAAAAATCAAGATAGAGTCATTATTTCTTCTTAGGAATCAAGGAGGAGAGTAACATTA AGAGTAGAAAAATTCCTAGACCACAAATAGAGTTTTCAGAGGTATCCTTTGTGGAGCCATCCAACTTGTTAGTATTTTCC CTCGTTGTAACAGATCCCTTTATTTTTGTGTTAGTTGTTTTGATGGTATTTTTGATTATCTGAGGTTGTGCAATTATAGA CACATTCCAGAGATAGAAGTCAGTTTTTATGAGTGACCCACTCGTAACTCCTGCCCCCAAGACAGCAGTGCCACTGGAGG AATATACATAAAATAGCCATATATACTCATGCCTCTCCTCCAATGGTATTGTATAATTGATTTCTATTGT