tg0376

Coordinates:358690-359118

>tg0376 hypothetical protein TGAM_0376
MLMRQSLRILLMLVLAEGLFALSLVPTASAEEEKQTRILIIDGSYPSSFLSGVSGYGESSVLDAMDVAKYSEEYLKENFD
LFVVTAELSGWSIGWEDYPSLVGKLWNAVEAGKSIIIVTYEDYSSPANTVISNCNLDKSFPNT

>tg0376 hypothetical protein TGAM_0376
ttgctaatgaggcaatccttgagaattttacttatgcttgtcttggcggagggattatttgccttgtccttggtaccaac
ggccagcgcagaagaagaaaagcagacaagaattctaataattgatggaagttaccctagttcatttcttagtggagtct
caggatatggggaaagtagtgtattagatgcaatggatgtagccaaatacagtgaggagtatttaaaagagaattttgat
ttatttgtagtcacggcagagttaagtggttggagtattgggtgggaggattatccatcactggtaggaaagctctggaa
cgcggtagaagctggaaagtcaataataattgttacctatgaagactattcgtcccctgcaaatactgtaatctcgaact
gtaatctcgataagtcatttcccaacacc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 358190 - 359618 (Additional range around tg0376 is :500nt.)

>Thermococcus gammatolerans EJ3 TGCTTTTCCGTTTTGGCGACCACGTGAAGTGACCCATAACTACGATCTATCCACCTGCCTTTAGATTCGACAATCCAGTT GTATATTCCGGAAGGGATTTTTGAATACAAAACATAAGTACCGACGGTTCCATCATTATCGAGAATAACCTCCCCCTCTC TCAGGAATGTGTGGTCTTCCCGTCCAATATTCCATCCTGCTTCTTTCATTTCTTCGAGAGAATCATATGAAAAGTCATCT CTCCATGTATTCGAGCTTGTGTCTTCAGCTCTGACAATTGTTCCTCCAAGAGGGCACAATGGGAGGAATAACATGAATAT CAACAGAACGGTAAATAATCCTTTTTTCATAAATCCCGCCTCCCACACCTCCTCAATAGATAGTTTGACATAACATTGAA CTAAGATGATTTAAATTTTTCTATATCTCAAATATCCCTCAGTCAGAGGCTGAAAAAGAGAAAATGTTAAAATATCCCAA AGCAAAAATCTAATCGGTGA ttgctaatgaggcaatccttgagaattttacttatgcttgtcttggcggagggattatt tgccttgtccttggtaccaacggccagcgcagaagaagaaaagcagacaagaattctaataattgatggaagttacccta gttcatttcttagtggagtctcaggatatggggaaagtagtgtattagatgcaatggatgtagccaaatacagtgaggag tatttaaaagagaattttgatttatttgtagtcacggcagagttaagtggttggagtattgggtgggaggattatccatc actggtaggaaagctctggaacgcggtagaagctggaaagtcaataataattgttacctatgaagactattcgtcccctg caaatactgtaatctcgaactgtaatctcgataagtcatttcccaacacc TAAAGAGTTCGTTGAATATAATGTTATTC CTAGTGACCTCACGCAAGAGGTTAAGAAGATAGAGTGTTCGGGAGTCAACTATTTTATTTATGGGAGCAGTCCCCTGGTT TTATCACCATCAAAATCTGGTTATCCTGATCCACCAGGAGCCCTGGCAGTCTACGGAACTTACGGGAAGGGAAAGTATGC CGTAGTTTCATGGGAACTTTTTGTCTCCGGTTATTGTAGAGGTGACGTTGGCCCTCTGTTCAGCGACATTATGCACTGGC TCACAAACCGCGAGATTCCCGCCCCACTAACTCTCAATGAAATGATGCAAAAAGTTCAAACTATTAATCAAACCCTGAAC ACCCTTTATTCTGAAGCTCAGGATATCAAGAGGGAACTCGAAAAGACAAAACAAGAAGCCCAGAATTTACCCTCAGTTTC AAAGAGGATTGATGAGGTAGAAAAAAGAGTCGAAAACAATGAAGAGCAAATCGGCGAACTTTCACAGCAC