tg0382

Coordinates:364560-365264

>tg0382 hypothetical protein TGAM_0382
MRLSRLEVLSLILALMLSLVFLDMFPVYIQKDVTIGIFILIEAIISLFLFLLMRWGYSALAGAIAATSLGVLILLRPPAI
YIGAVPVTWWAIGALYLVIIVVGIALASPMDEKRLNLISLLFASIFLLIGLIAAYEGLKLPLPPDVLRGLSAATKMKTWR
SMGILLGIMNAGATISMLRGKYLHYLLLISFTLPPLFTVTLSFDKITFGVFSQVLLLAQVGVSGLLVSWYMGSRR

>tg0382 hypothetical protein TGAM_0382
ATGAGACTCTCACGGCTTGAGGTACTTTCACTCATACTGGCGTTGATGCTCTCATTGGTTTTCCTCGACATGTTCCCAGT
GTATATCCAAAAAGACGTGACAATCGGAATTTTCATCCTTATCGAGGCCATAATAAGCCTGTTCCTGTTCCTCCTTATGA
GATGGGGCTACTCTGCACTCGCAGGGGCCATAGCGGCGACTTCACTTGGCGTGCTGATCCTCCTCAGACCACCCGCCATA
TACATAGGGGCGGTTCCCGTAACCTGGTGGGCGATTGGCGCTCTCTATCTGGTGATTATCGTTGTAGGCATTGCCCTAGC
CAGCCCGATGGACGAGAAGAGGCTAAACCTTATCTCCCTTCTCTTCGCCTCGATATTTCTGCTCATAGGCCTCATTGCAG
CCTACGAAGGGCTTAAGCTCCCCCTTCCTCCCGACGTCCTCAGGGGACTCAGCGCCGCAACCAAGATGAAAACCTGGAGG
AGCATGGGCATTCTGCTTGGCATTATGAACGCGGGGGCAACCATCTCAATGTTGAGGGGCAAGTACCTCCATTACCTCCT
GCTGATAAGCTTCACACTGCCTCCGCTCTTCACGGTTACCCTGTCCTTCGATAAGATAACGTTCGGCGTGTTTTCCCAGG
TTCTCCTGCTCGCCCAGGTGGGGGTCTCCGGACTCTTAGTCTCATGGTACATGGGGAGCAGAAGG


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 364060 - 365764 (Additional range around tg0382 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTCCCAGTCTGCTGCTCTTGATAGTCATAGCGGCGCTCTTCTCCAATGTCTGGAACATATGGTACACGATAATCGTGAT AGCCCTCATCGCGTGGCCCTCAACGGCAAGAATGGTGAGGGCACAGACACTCCAGCTAAAGAACAGAACCTACGTTGAGG CGGCGATAGCACTAGGGGCCAGCAAGGGGAGGATAATCTTCAGGCACATACTCCCCAGCACGATACCCCTGCTCTTCGCC AGAGCCACGATTCAGATAGCGGGCTTCATAGTTACCGTGGCGTCACTGACTTTCCTCGGCCTCGGCGACCCCCACAACCC CGACTGGGGCTACGTCATGTACACGGCCAACAAGAACATGATGATGATAGTGATGAAGGGCATGTGGCAGTGGATCATAG TCCCCGGTGTGATGATAGCGCTGGCTGTAATAGCGTTCGTGTGCCTTGGCGAGGCCCTTCAGGACTACCTCAACCCGAAG CTCAGGAGGAGGTGATCTG ATGAGACTCTCACGGCTTGAGGTACTTTCACTCATACTGGCGTTGATGCTCTCATTGGTT TTCCTCGACATGTTCCCAGTGTATATCCAAAAAGACGTGACAATCGGAATTTTCATCCTTATCGAGGCCATAATAAGCCT GTTCCTGTTCCTCCTTATGAGATGGGGCTACTCTGCACTCGCAGGGGCCATAGCGGCGACTTCACTTGGCGTGCTGATCC TCCTCAGACCACCCGCCATATACATAGGGGCGGTTCCCGTAACCTGGTGGGCGATTGGCGCTCTCTATCTGGTGATTATC GTTGTAGGCATTGCCCTAGCCAGCCCGATGGACGAGAAGAGGCTAAACCTTATCTCCCTTCTCTTCGCCTCGATATTTCT GCTCATAGGCCTCATTGCAGCCTACGAAGGGCTTAAGCTCCCCCTTCCTCCCGACGTCCTCAGGGGACTCAGCGCCGCAA CCAAGATGAAAACCTGGAGGAGCATGGGCATTCTGCTTGGCATTATGAACGCGGGGGCAACCATCTCAATGTTGAGGGGC AAGTACCTCCATTACCTCCTGCTGATAAGCTTCACACTGCCTCCGCTCTTCACGGTTACCCTGTCCTTCGATAAGATAAC GTTCGGCGTGTTTTCCCAGGTTCTCCTGCTCGCCCAGGTGGGGGTCTCCGGACTCTTAGTCTCATGGTACATGGGGAGCA GAAGG TGAGTTAGATGATCCTAGGGCTCGACTGCGGTGGAACGAAAACGCACGCGGTGCTGGTTGATTGGAACGGGGAA GTACTCGGAGAAGGGTTTGGGGGGCCATCAAATCCGAACGCCTCGCCAATGGAGACTGTGAGGGCTTCAATAAGGAAAGC CGTCTCGGAGGCACTCGGCAATTTCCGGGGTTCGGTCAAAGTTGCCTGCGTTTCCGCCGCTGGAACACTGGGGGGAATGA AGGATATCTTAGAGGGAATCCTCGGGGAGCTCCTTCCCGGGGCAGAAATAATCGTGAAGAGGGACTACGAAATAGCCCAC GTGGCATGCTTTCTCTTTAACCCAGGCGTCGTCTTAATCGCCGGAACGGGCTCGATTGCTTATGGAATCAACGAGGAAGG CAAAACCGTCAGGGTGGGTGGTTGGGGACACCTTGTGGGTGATGAAGGAAGCGGGTTCTGGGTTGGGAAAGAGGGAATCA GGGCCGCCCTAAGGGCCTACGACGGA