tg0383

Coordinates:365272-366162

>tg0383 ABC-type dipeptide/oligopeptide transport permease protein appC (appC)
MAMTLREKLEEKWESLKEVSGYVWHHKMGKVGVIILAFLLIMALFPGLFTKYTPDWTSDETFVPASWDHPCGIDQEGKDI
WAQIVYGTRISLAVGFIAALLTVTIGALVGTVAGYYGGIVDEILVFVSDSIMMLPSLLLLIVIAALFSNVWNIWYTIIVI
ALIAWPSTARMVRAQTLQLKNRTYVEAAIALGASKGRIIFRHILPSTIPLLFARATIQIAGFIVTVASLTFLGLGDPHNP
DWGYVMYTANKNMMMIVMKGMWQWIIVPGVMIALAVIAFVCLGEALQDYLNPKLRRR

>tg0383 ABC-type dipeptide/oligopeptide transport permease protein appC (appC)
atggcaatgaccctgagggagaaacttgaggagaaatgggagtccctcaaggaggtctccggctacgtttggcaccacaa
aatgggtaaggttggcgtaataatactcgcattcctcctcattatggccttattcccgggcctttttacgaaatacactc
cagattggacatcggatgaaacattcgttccagcatcgtgggatcatccgtgcggtatagatcaggagggaaaggacatc
tgggcccaaatagtctacggaacgaggatttcactggcagtgggtttcatcgccgccctgctaaccgtaacgataggggc
actcgtcggtaccgttgcaggctattacgggggcatcgtcgatgaaatcctcgtcttcgtatcggactccataatgatgc
ttcccagtctgctgctcttgatagtcatagcggcgctcttctccaatgtctggaacatatggtacacgataatcgtgata
gccctcatcgcgtggccctcaacggcaagaatggtgagggcacagacactccagctaaagaacagaacctacgttgaggc
ggcgatagcactaggggccagcaaggggaggataatcttcaggcacatactccccagcacgatacccctgctcttcgcca
gagccacgattcagatagcgggcttcatagttaccgtggcgtcactgactttcctcggcctcggcgacccccacaacccc
gactggggctacgtcatgtacacggccaacaagaacatgatgatgatagtgatgaagggcatgtggcagtggatcatagt
ccccggtgtgatgatagcgctggctgtaatagcgttcgtgtgccttggcgaggcccttcaggactacctcaacccgaagc
tcaggaggagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 364772 - 366662 (Additional range around tg0383 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCGCGTTCAAGCTCGGCCTCTTCCCGTTTCTAACCTCATCCGAGCTTCACCCCCGTAACGTGTTTCATCACATGATAGA CTGGTTGTGGCACAGTCTCCTTCCCATCATAGCCCTCTCCAAGATCTACGCAGTCTCGTACCTCCTCACAATCAGGAACA TGGTATCCGAGGAATACACCAACGACTACGTTGTCTCATTTCGTGCTATGGGCCTACGGGAAGACTACATCATCGAGAGA TACGTTCTCAGGAGCATAATGCCCCCAATAATCACGATGATGGCAATAGACCTCGGCTTCCTCTTCGGTGGAGCCGTTGT CACCGAGACAGTCTTCAACTATCCGGGCATGGGGACACTGATATACACTGCCATCTGGAACAAGGATTACCCGGTGGTTT TGGCCTCGTTTTACATAATAGCGGTCGCCGTGATACTCGCCATCACGATAGCCGAGATAACCTACGCCTACCTCGACCCG AGGATCAGGAGGGGATAAA atggcaatgaccctgagggagaaacttgaggagaaatgggagtccctcaaggaggtctcc ggctacgtttggcaccacaaaatgggtaaggttggcgtaataatactcgcattcctcctcattatggccttattcccggg cctttttacgaaatacactccagattggacatcggatgaaacattcgttccagcatcgtgggatcatccgtgcggtatag atcaggagggaaaggacatctgggcccaaatagtctacggaacgaggatttcactggcagtgggtttcatcgccgccctg ctaaccgtaacgataggggcactcgtcggtaccgttgcaggctattacgggggcatcgtcgatgaaatcctcgtcttcgt atcggactccataatgatgcttcccagtctgctgctcttgatagtcatagcggcgctcttctccaatgtctggaacatat ggtacacgataatcgtgatagccctcatcgcgtggccctcaacggcaagaatggtgagggcacagacactccagctaaag aacagaacctacgttgaggcggcgatagcactaggggccagcaaggggaggataatcttcaggcacatactccccagcac gatacccctgctcttcgccagagccacgattcagatagcgggcttcatagttaccgtggcgtcactgactttcctcggcc tcggcgacccccacaaccccgactggggctacgtcatgtacacggccaacaagaacatgatgatgatagtgatgaagggc atgtggcagtggatcatagtccccggtgtgatgatagcgctggctgtaatagcgttcgtgtgccttggcgaggcccttca ggactacctcaacccgaagctcaggaggagg TGATCTGATGAGACTCTCACGGCTTGAGGTACTTTCACTCATACTGGC GTTGATGCTCTCATTGGTTTTCCTCGACATGTTCCCAGTGTATATCCAAAAAGACGTGACAATCGGAATTTTCATCCTTA TCGAGGCCATAATAAGCCTGTTCCTGTTCCTCCTTATGAGATGGGGCTACTCTGCACTCGCAGGGGCCATAGCGGCGACT TCACTTGGCGTGCTGATCCTCCTCAGACCACCCGCCATATACATAGGGGCGGTTCCCGTAACCTGGTGGGCGATTGGCGC TCTCTATCTGGTGATTATCGTTGTAGGCATTGCCCTAGCCAGCCCGATGGACGAGAAGAGGCTAAACCTTATCTCCCTTC TCTTCGCCTCGATATTTCTGCTCATAGGCCTCATTGCAGCCTACGAAGGGCTTAAGCTCCCCCTTCCTCCCGACGTCCTC AGGGGACTCAGCGCCGCAACCAAGATGAAAACCTGGAGGAGCATGGGCATTC