tg0400

Coordinates:386460-386921

>tg0400 hypothetical protein TGAM_0400
MLGFLRRKKTYGPFVYLSEPTFLYHTRTEKAILKIIEEKLNSNNILVPSKYGLRDTSDRIRDAEYFVAVAPLGKFTSLVG
REVKLAQELGVKIFTLLIARKGDELVYLWVEGVPEDVEWLSPEETMEFTKTFINSEFMDFLKHGLFFGSRKREW

>tg0400 hypothetical protein TGAM_0400
atgctcggatttttgaggaggaagaaaacctacgggcccttcgtttatctgagcgagcccacttttttataccacaccag
aaccgagaaggcaatcctcaagattatcgaagaaaaacttaactccaacaacatcctcgtgccctcgaaatacggcctaa
gggacacgagcgacaggattagggatgctgaatacttcgttgccgtcgcccccctcgggaagttcacctctcttgtcggc
agggaagtcaagctcgcacaggagctcggcgttaaaatcttcaccctcctcatagcgaggaagggggatgagctcgttta
cctctgggtcgagggcgttcccgaagatgttgaatggctctcacccgaggagactatggagttcaccaagacctttatca
acagtgagttcatggacttcctcaaacacggactgttcttcggctcaagaaaaagggaatgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 385960 - 387421 (Additional range around tg0400 is :500nt.)

>Thermococcus gammatolerans EJ3 GAAGAAGCGACTTCCCGAACCAGATAAACAACGTTCTCGGCTTTCCGGGGATTTTCAGGGGGGCGCTTGACGTGAGGGCG AGGGACATAACGCTCGACATGAACATCGCGGCGGCAAAAGCTATAGCCAGCTGTGTGAGCGATGAGGAGCTCAGCGAGGA TTACATAATCCCCACGCCCTTCCATCCCGACGTCTATCCGAAGGAGGCGAGGGCCGTTGCGGAACAGGCCGTAAAGGACG GCGTTGCGAGGAAGAAAGTGAGCGGGGAATGGGTGGAGGAGCACACGAGGAAGCTCAGGAGGTTCTACGAGGAGGTAATC GCTCCGGTCAACGAGAAGAGGAAGAACTTCAGCTGACGTTTCTTTCACTTTTGGGGTAAAACCTTTTAACCTCCCTTTTT TGAGTATCCTTGAGCGAAAAGATTTGACTTGCGAACCGATGAGGAGTGTCATCCCTCCTGATGTCGAGATGATGACATTA TCCCCACCTGAGGTGGTCTT atgctcggatttttgaggaggaagaaaacctacgggcccttcgtttatctgagcgagcc cacttttttataccacaccagaaccgagaaggcaatcctcaagattatcgaagaaaaacttaactccaacaacatcctcg tgccctcgaaatacggcctaagggacacgagcgacaggattagggatgctgaatacttcgttgccgtcgcccccctcggg aagttcacctctcttgtcggcagggaagtcaagctcgcacaggagctcggcgttaaaatcttcaccctcctcatagcgag gaagggggatgagctcgtttacctctgggtcgagggcgttcccgaagatgttgaatggctctcacccgaggagactatgg agttcaccaagacctttatcaacagtgagttcatggacttcctcaaacacggactgttcttcggctcaagaaaaagggaa tgg TGAAGGAAACTCATGCGCTGGCTTTCTTTGCCCTGACGTATTCGTCTATCGCCTTCGCCGCCCTCTTACCGTCGCC CATCGCTAAAATTACCGTAGCCTCGCCCCTTATCGCGTCACCTCCAGCGAAGACACCCGGGATGCTCGTCATGAGGTTCT CGTCCACGACGAGCGTTCCGTTGGGGTTGGTTTTCAGCCCGGACTCCTCGCTGATTATTCTGTTGGGCTCCAGTCCAATA GCTATTATCACCGTGTCTGCTTCGACTGTGATGTACTCCCCAGTGGGCCTTATCTTCCTCTTTCCGCGCCTGTCGCGCTC CTCCAGCGGTTCCATCTTCTCGAACTTAACTGCTTTGACCTTGCCGTTCTCGTCTCCTATGAACTCGACCGGCTGGACGA AATAGAGGAACTTCACGCCCTCCTCCTTCGCGTGCTCGACTTCCTCAATCCTTGCCGTCACGTCTTCCTCGCCGCGCCTG TAGGCTATCGTCACGTCGCAGCC