tg0402

Coordinates:388351-389199

>tg0402 Cytochrome-c3 hydrogenase, gamma subunit
MGYRITAKEDLSPIDYFVEVEAPHVARAWKPGQFVVFILHERGERVPMSVYKAENGRVGMFIRKLGKTSMQLYYEYKPGD
ELWSFVGPLGKPIKIKNYGSVAFVSDAVCGQAENYATLKAMREAGNYTISVQTFEDRERVYPEKFLAREVADEYYLTTLD
GSVGLKGHYLDVVKELIEKDKVDVIFAGGKLGSLAKLAELTRPYGIPTYATVRQIMVDGTGMCGSCRVLYDSEVKFACRD
GPVFDAHKIDWEDAIRRNAERFAEQERLAKERYLEYLRAKGVI

>tg0402 Cytochrome-c3 hydrogenase, gamma subunit
ttgggatacagaattaccgcgaaggaggatttgagcccgattgactattttgtggaggtggaagccccgcacgtcgccag
ggcgtggaaaccgggccaattcgttgttttcattctccacgagaggggagaaagggttccaatgtcagtctacaaagccg
aaaacggaagggttgggatgttcatcaggaagctcgggaagacgagcatgcagctctactatgagtacaagcctggagac
gagctctggagctttgttgggccgcttgggaagcccataaagattaagaactacggcagcgtcgcttttgtttccgatgc
agtctgcggccaggccgagaactacgccaccttaaaggcgatgcgcgaggcaggaaactacactatctcggttcaaacct
ttgaggacagggagagggtctaccccgaaaagtttctcgcgagggaagtcgccgatgagtactacctgacgaccctcgac
ggttccgtcggtttgaagggccactatctggacgtcgtgaaggagctcatagagaaggacaaggttgacgtgatctttgc
cggcggaaaactcggctcgctcgcgaagcttgcagagctcacaagaccctacggaatcccgacctacgctaccgtgagac
agattatggtcgatgggactggaatgtgcggttcgtgcagggtcctctacgacagtgaggtgaagttcgcctgcagggac
gggccggtcttcgatgcccacaagatcgactgggaggacgcgataaggaggaacgcggagcgctttgccgagcaggagag
gctcgccaaggagcggtacctcgagtacctccgcgccaagggggtgatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 387851 - 389699 (Additional range around tg0402 is :500nt.)

>Thermococcus gammatolerans EJ3 GAGGTTTATCTCAAGCTTGGCGTTTAAGGCTTTTGCAAGCTCAATTGTTTCCTTTGGGACGAGCGCCGCAACGTTGCCGT TAACCGAGATCACCGGGTGTTTAGCCAAGAGAAACTTTGCAACGGCAGCCATCATTGCCCTCTCCGCAGGCTCTATCGTT TTCTCGCCGATCAGGTAGTCAAAGGCCTCCCCACGTCCGTGTGCAATTAGACCGGCCTTGGCGGTCATCCCCTTCTCCAT TCCCTCGATGATTTTCTCTCGGTAGTAGAGACTCCAGTAGCGCGGATGACTCTTGGGGATCTTCACCATTCTAACCACCG AGGGGGTTTCTCCCAACCCCTAATAAACCTGTCCCAGCGACTCCATCTGAAAAAACCAGCTTGTTTCTCTTCTTTCGGCT GGAGAGGGGTTCTAAACCTTTGGTTCAGGAAAACCCTATAAGCTTTAGGTTCAAAACTTATGGTGAACAACGTTGTTCCC GTGAACGGGGGTGTTCATC ttgggatacagaattaccgcgaaggaggatttgagcccgattgactattttgtggaggtg gaagccccgcacgtcgccagggcgtggaaaccgggccaattcgttgttttcattctccacgagaggggagaaagggttcc aatgtcagtctacaaagccgaaaacggaagggttgggatgttcatcaggaagctcgggaagacgagcatgcagctctact atgagtacaagcctggagacgagctctggagctttgttgggccgcttgggaagcccataaagattaagaactacggcagc gtcgcttttgtttccgatgcagtctgcggccaggccgagaactacgccaccttaaaggcgatgcgcgaggcaggaaacta cactatctcggttcaaacctttgaggacagggagagggtctaccccgaaaagtttctcgcgagggaagtcgccgatgagt actacctgacgaccctcgacggttccgtcggtttgaagggccactatctggacgtcgtgaaggagctcatagagaaggac aaggttgacgtgatctttgccggcggaaaactcggctcgctcgcgaagcttgcagagctcacaagaccctacggaatccc gacctacgctaccgtgagacagattatggtcgatgggactggaatgtgcggttcgtgcagggtcctctacgacagtgagg tgaagttcgcctgcagggacgggccggtcttcgatgcccacaagatcgactgggaggacgcgataaggaggaacgcggag cgctttgccgagcaggagaggctcgccaaggagcggtacctcgagtacctccgcgccaagggggtgatc TGAATGCCGA AGCTCATCAAGGAGAGGGTCCCTACCCCAGAGAGGCCCGTTGAGGAGAGGGTTAAGGATTTTGGTGAGGTCAACCTCGGT TATACCTTCGAGCTTGCCGTTAAGGAGGCCGAGCGCTGTCTCCAGTGTCCCGAGAACTACGCGCCCTGTATAAAGGGCTG CCCCGTCCACATCAACATTCCGGCCTTTATAGCCAAGATCAAGGAGGGCGACATCAAAGGCGCCCTGAGAATAATCTGGA ACGACAACACCCTACCTGCGATAACCGGCCGCGTCTGCCCGCAGGAGGACCAGTGTGAGGGTGCCTGTGTCGTTGGAAAA GTCGGGGATGCGGTAAACATCGGCAAGCTGGAGAGGTTTGTAGCCGACTACGCGAGGAAGCACGGCATCGAGGAGGAGCT CCTCTGTGAGTTCGAGGAGAAGTGTACAGGAGAGCGTGGAAAGGTTGCAGTCGTCGGTGCGGGGCCAGCTGGACTGACGT GTGCCGGCGA