tg0420

Coordinates:413909-414460

>tg0420 2′-5′ RNA ligase (ligT)
MRAFIAIDVSDEVRDNLLKAQERIGSKAAKIKFVERENFHVTLKFLGEIDEVTAEEVKKALAEIARKHKKHRVRVKGIGV
FPNPNYVRVIWAGIENDEGIKAIANDVEREMRRLGFKKDKDFVAHITIGRVKFVRDKVELAMALKDLANEDFGEFEVEAI
ELKKSTLTPKGPIYETVAKFELAE

>tg0420 2′-5′ RNA ligase (ligT)
atgagggcgttcatagcgattgatgtgagcgacgaggttcgcgacaacctcctgaaggcccaagagaggatagggagcaa
agctgccaagataaagttcgtcgagagggagaacttccacgtcacgctcaagttcctcggcgagattgacgaggtaacgg
cggaagaggttaagaaggccctagccgagatagcgagaaagcacaaaaagcatcgcgttcgcgttaagggaatcggcgtc
ttcccgaacccgaactacgtaagggtgatatgggccggaatagagaacgacgagggaataaaagcgatagcgaacgacgt
cgagcgcgagatgcgtcgcttaggcttcaagaaggacaaggacttcgtggcccacataacaatcggacgcgtcaagttcg
tccgcgataaggttgaactggcgatggcgctcaaagatcttgccaacgaggacttcggcgagttcgaggtcgaggccata
gagctgaagaagagcacgctgacgccaaagggtccgatttacgagacggtagcgaagttcgagctcgcggag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 413409 - 414960 (Additional range around tg0420 is :500nt.)

>Thermococcus gammatolerans EJ3 CAAGGTTTACCTGACCTGGTGGCAGGTTGATAGAGCAGTCTTCGCGCTCGCTGAGGAGATACGAAAGCACTTCATGCCCG ACGTGATAGTTGGAATCGCGAGGGGAGGCTTAATCCCGGCCGTGAGACTGAGCCACGTTTTAGGAGACGTCGAGCTCAAG GTCATAGACGTCAAGTTCTACAAGGACATCGAAGAGAGAATGGAGAAGCCGAAGATAACGATTCCACTCCACGGCTCACT GGAAGGCAAGAAGGTCGTCATAGTTGACGATGTGAGCGACACGGGGAAGACCCTTGAAGTCGTCATCGAGGAGGTCAAGA AGGCCGGGGCGAAGGAGGTTAAGGTTGCCTGCCTCAGCATGAAGCCCTGGACGAAGGTCGTTCCCGACTTCTACGTTTTC CGCACAGACAAATGGATAGTCTTCCCCTGGGAGGAGTTCCCGGTTGTGGTGAGGGAGTAACCCCTTTTAACCCCTCCCCC AACTTTTCCTGGTGGTGGT atgagggcgttcatagcgattgatgtgagcgacgaggttcgcgacaacctcctgaaggcc caagagaggatagggagcaaagctgccaagataaagttcgtcgagagggagaacttccacgtcacgctcaagttcctcgg cgagattgacgaggtaacggcggaagaggttaagaaggccctagccgagatagcgagaaagcacaaaaagcatcgcgttc gcgttaagggaatcggcgtcttcccgaacccgaactacgtaagggtgatatgggccggaatagagaacgacgagggaata aaagcgatagcgaacgacgtcgagcgcgagatgcgtcgcttaggcttcaagaaggacaaggacttcgtggcccacataac aatcggacgcgtcaagttcgtccgcgataaggttgaactggcgatggcgctcaaagatcttgccaacgaggacttcggcg agttcgaggtcgaggccatagagctgaagaagagcacgctgacgccaaagggtccgatttacgagacggtagcgaagttc gagctcgcggag TGAGTGCAATGGAGATGGAAGAAGTCCTCAGCGAAGTCATTCAAAGGATAAGGCCAAGCGATGAAGA GAGAGCCTTCGTGAAAGGCCTGATGGAGGAGCTGAGAACAATAGCCGAGGAGAGAATAGAGGAGCTCGGCCTCGACGCTA GGCCCTACTTCGTCGGCTCACTCGCGAAGGATACTTATCTGGCTGGAGACCACGACATTGACCTATTCCTGGCCTTTCCC CTCGAAACTCCCCTTGAGGAGCTGAGGAAAAAAGGTCTGGAACTCGGAAAAGCCATAGCCGAAAAACTCGACTCCCACGA GATAGCCTACGCGGAACACCCCTACGTCCGGGCGAGATACAGGGGAGTGCGCGTTGACCTCGTGCCCTGCTACGACGTCG GAAACTGGAGGGATGTGAGAACTGCCGTTGACCGCTCGATACTCCACACGAGGTGGGTGAATGAGAACCTCAGGGGGCGG AACGACGAAGTTAGACTGCTCAAGCGCTTCCTG