tg0431

Coordinates:425987-426841

>tg0431 Agmatinase, putative, arginase family protein (speB)
MEFLYTYEAFKLELPLVSPERADFVILGVPFDGTTSYKSGARFGPTLIRQATLNLESYVLDYDIDIADLPIADIGDIAVV
AGDPRKTADRVRETIEELERVNPKAIPVLLGGEHSQTLGAVEALKPKSYVVFDAHLDLRDSYEDNPYNHACVARRIAELG
IREAMFGIRSGTREEVEFAEKNGIRWVHARDYGFDSFVDLVEPLPEPVYLSVDIDVFDVSMVPDTGTPEAGGLRFWEVIE
AIEWLTANKRIVGFDIMEVAGERLGNPTALTAAKLLFYFLAMMKR

>tg0431 Agmatinase, putative, arginase family protein (speB)
ttggagttcctgtacacgtacgaggcctttaagctcgagcttcccctcgtttcccctgagcgcgcggattttgtaatctt
gggcgtaccctttgacgggacgaccagctacaagtcaggggcacgctttggccccactctcataagacaggcgacgctga
accttgagagctacgtactcgactacgacattgacatagccgatcttccaatagccgatataggggacatcgccgtcgtg
gcgggcgatccgagaaagaccgccgatagagtcagggaaactattgaggagctggaacgggtaaaccctaaagcgatccc
ggtgctcctcggcggtgagcactcccagacgctgggagcggttgaggcactaaagcccaagagctacgtcgtcttcgatg
cccacctcgacctaagggacagctacgaggacaatccctataatcacgcctgtgtcgcgagaagaatagcggagctcggc
attagggaagcgatgtttggaataaggagcggtacgagggaggaggtggagtttgctgaaaagaatggaattcgctgggt
tcacgccagggactacggcttcgattccttcgtggatctcgttgaacccttgcccgagccggtttacctctcggtggata
tagacgtctttgatgtttcgatggttcctgatactgggacgcccgaggccggtggtttgaggttctgggaggtaatcgag
gcaatcgaatggctcactgccaacaagagaatagtgggctttgacataatggaagtggcgggggagaggctggggaaccc
aactgccctgaccgctgcgaagctgctgttctacttcctcgcaatgatgaaaagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 425487 - 427341 (Additional range around tg0431 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCCCAGTGAGTCCATCAGGACGTTCATCCCGACGAGGAGAGCCGTTAGTGCGTCGTTGAACTCCTCCTTTCCGAGGCTT TTCTCGTCAAGATCCACCCTCAGTGTTATTTCATCGTTCATCCCGCTGAGCGTGAACTTCAGCATGTTCATGCGCTCGTT CAGAACGAGTAGTGTGTGGTAAGTTTTAAGTCTCTCTTCGAGTCTCATGGCTATAGTTTCTATCCCCGAGGGGACAGCCA GCCGTATGAAGCCATCGGCAAAGACTACGTTAAGGATGAAGGGGATCTTCGGATGCTCGGCAACGTAGTGGTTTTCCTCG ACCTTCTTGACTTCCCAGGGGAGATCGACGATATCTTCCGCATCGTCCCTACCGCTCCGGAGCCACTCCAGAACTGCCTC GCTCAAAATCACCACCGTAGAAACTACGTCGTTCCGGGTAAAATAATTTTGCCCATAAAGCTTTTTTAGCCTTCATCAAT CCATGCCCGGGGGTGGAAAG ttggagttcctgtacacgtacgaggcctttaagctcgagcttcccctcgtttcccctga gcgcgcggattttgtaatcttgggcgtaccctttgacgggacgaccagctacaagtcaggggcacgctttggccccactc tcataagacaggcgacgctgaaccttgagagctacgtactcgactacgacattgacatagccgatcttccaatagccgat ataggggacatcgccgtcgtggcgggcgatccgagaaagaccgccgatagagtcagggaaactattgaggagctggaacg ggtaaaccctaaagcgatcccggtgctcctcggcggtgagcactcccagacgctgggagcggttgaggcactaaagccca agagctacgtcgtcttcgatgcccacctcgacctaagggacagctacgaggacaatccctataatcacgcctgtgtcgcg agaagaatagcggagctcggcattagggaagcgatgtttggaataaggagcggtacgagggaggaggtggagtttgctga aaagaatggaattcgctgggttcacgccagggactacggcttcgattccttcgtggatctcgttgaacccttgcccgagc cggtttacctctcggtggatatagacgtctttgatgtttcgatggttcctgatactgggacgcccgaggccggtggtttg aggttctgggaggtaatcgaggcaatcgaatggctcactgccaacaagagaatagtgggctttgacataatggaagtggc gggggagaggctggggaacccaactgccctgaccgctgcgaagctgctgttctacttcctcgcaatgatgaaaagg TGA GGTCAGCCGAAGAAGGCCCCCATCATGTCCATCTGCTCGTCGCTCATGGACTTTACTTTGAACTCGGGCATCTCCCCTTT GAGCTTCTCGTAGTCTTCCTTCGTTATCTCTCTCGCCTCACCGTCCTCGACGAGGTAAAAGATGCCGTAGTCAGGGTCAC GGTAGGCAACGAGGAACTTCTCCACCTCGATGTCGTCGAAGTTCACGAAGATGACGTTTCCACCTGTGTAGGGCCTCCTG CACTTGAAGGGAAAGCTGGAGGAGTTGAGCATGGCATCGCCCAGGGCCTGGTTGGCCCTCTCCCCGTTTATCTCGGTCCA GAAGGGTCTTCCCTCGAAGTCGCCCTCAACGACGATGAGGAACCTCTGGCCGTCGAGCTCGACTATCGGGGCGCCCTTCT CCTGAAGTATCTTGAAGAGCTCGCCGATTGTCTCGGCGTTTCTGAGCGAAGCAACAAATCCTTCAACCTTCATAGTTTTC ACCGTTAGAGGTTCTG