tg0435

Coordinates:430476-430718

>tg0435 Transcription regulator, SpoVT/AbrB family
MMGVEVVKVSTKGQVVIPKEIRDALGIRNGDYLVVMEKNGYIVMKKLSVEDVFKEGEELAKTLEITREDVIRAVGDVRYE
D

>tg0435 Transcription regulator, SpoVT/AbrB family
gtgatgggggtggaggtagtgaaggtatccaccaaggggcaggttgtcatacctaaggaaatccgcgatgcccttgggat
acggaacggggactatctcgtcgtgatggagaaaaacggctacatcgtgatgaagaagctgagcgttgaggacgttttca
aagagggtgaggaactcgcaaagacccttgaaatcacgagggaagacgtaatcagggccgtgggggatgtgaggtatgag
gat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 429976 - 431218 (Additional range around tg0435 is :500nt.)

>Thermococcus gammatolerans EJ3 AATTGGCTGACACTAACGAGAGGCCAAAGGACAGGCCTCCCTACCTGCGCCTCGCTCCCCTCGCGGAGATAATCTCGATG GTCATCGGCAAGGGAGTTGAAACCAAGGCCGTTAGGCTGATATGGGAACGCTTTTTGAGGGAATTTGGGAGCGAGATTAT GGTTCTCGTTGACGTTCCCGTGGGGGAGCTTGCCAGAGTCCACGAGGAAGTGGCAAAGGCTATATGGGCCTACCGCAACG GGAAGCTCATCGTTATCCCGGGTGGTGGCGGGAAGTACGGGGAGATAAAGCTCCCTGAGGAGATAAGGAGGGCGAGGGTT GAGGAGCTTGAGAGCGTTGAGGTGGAAGTTCCTGAGGAAACCGAGAGGCTGAGGCAGAGGAGCATAACGGACTTCCTCAA GGTTGCCAGGTGAGATCGGCAGAATTTGTGAAAAGTTGCCAAACGTGATTGGCAAGTTTGCCCGAAAGGGTAATAAGTAA GAAAGTAGGAAATTCCTACG gtgatgggggtggaggtagtgaaggtatccaccaaggggcaggttgtcatacctaagga aatccgcgatgcccttgggatacggaacggggactatctcgtcgtgatggagaaaaacggctacatcgtgatgaagaagc tgagcgttgaggacgttttcaaagagggtgaggaactcgcaaagacccttgaaatcacgagggaagacgtaatcagggcc gtgggggatgtgaggtatgaggat TAGGAGAATTCTGCTTGTCCAACCATTGCTTCAAAATCTTAAAGCCGGGTGAGTT CAAATGATGGAATCCGAAATCATAGAGCTCTTCATCAGGCACCTCAAACGACAAGGTGATTTACCCCTCGGCGATGATGC TGGGGCTTTAAGGCTCGGTGATAGGTGGCTCGTTGCAACCAACGATATGCTCGTCAGGAAAACGGACGTGCCCGACATAA TGACGCCCGAGCAGGTTGGCTTCAAGGCGGTAACCATGAACGTGAGCGATATGGCTTCGATGGGGGCAGAACCGCTCGGC TTCCTCTTCTCCCTTGGGATTCCGGGGGATTTGGATTCGGACTACCTTGAGGGGATTGCGAGGGGAATCGGTGAGGCCCT CGACTTTTACGGCCTTCCTGTCCTGAGTGCTGACACCAATGAGGCCGATGATCTCATCATAGACGGGGCAGCGCTGGGTA TTACTGAGCGTTTGCTCACGCGCTCGGGGGCAAAACCCGGTGAG