tg0443

Coordinates:436287-437081

>tg0443 hypothetical protein TGAM_0443
MRVIEAILYFEALGRTRLAVEDRVRKTSRGLEGSRLDVKRLEVGEVIEEPELDPLRFSALLEARVEGGLEDLVEVVARYG
PTLVEILRPGRLELRAEDLSRLLLGLSRTISDLVEGDIQVPVPLSLKEIPVPQVGFDEEELWEMIYQDRGILYGLSLRLP
EEIAEDTLLKLLLLEGCGVNSIEARDLDGGSEFRLEVVSPFESLFAVVFKYRPFSLNVIEPEVFDITAPELQNALSDLGS
FVNSLLMGEDLQKAYERDTFSFKLV

>tg0443 hypothetical protein TGAM_0443
gtgagggtgatcgaagctatactctactttgaggcccttgggagaacgaggcttgcggttgaggacagggtgagaaaaac
ctcccgtggactagaggggtccaggttggatgtaaagcggctcgaggtgggggaggtcattgaggagccggaactcgatc
cccttcgcttttcggccctcctcgaggcgagggttgaggggggcctggaagatttggtcgaagttgttgctcgatatggc
ccaaccctcgttgagatcctcagaccgggcaggcttgaactccgtgccgaggacctctccaggcttttgctcgggctctc
gagaacgattagtgatctggttgagggggatatccaggtaccggttccgctgagcctgaaggagattccggttcctcagg
taggatttgacgaggaggagctctgggaaatgatctaccaggacaggggtattctatacgggctttcccttcgtctgccc
gaggaaatcgcggaggataccctcttaaagctcctcctccttgagggctgcggcgtcaacagtatcgaggctcgtgacct
cgatggggggagcgagttcaggcttgaagtggtttctccctttgagtcgctcttcgcggtggtgttcaagtacagaccct
tctcactgaatgtaatagaaccggaggtctttgacatcaccgcccctgagctccagaatgctctcagcgatcttggttcc
tttgttaactccctcctgatgggtgaggatcttcagaaggcctatgagagggacactttttccttcaaacttgtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 435787 - 437581 (Additional range around tg0443 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCGACGAGTTCTACATGAAGATAGCGAGCGTCCCGAGTGGTGAGCCGAGCAGGAGGACGGCGGTTATAGCGAAGAAGGA CTTTGGAATCCACGTTGAGCTGACGTACCTCATAATCCCGACGCTCAACGACAAGGAAGAAGAGATACGGGCCTTCGCCC GCTGGGTGGTTAATGAGCTCGGCGACGACACGCCCGTCCACTTCTCGCGCTTCTTCCCTCACTACAAGCTCCTCCACCTT CCGCCGACACCTCTTGAAACGATGGACATGGCCTACCGCGTCGCCAAGGAAGAGGGTTTAAAGTTCGTTTACATCGGCAA CGTTCCAGGGCACCCTGGGGAGAACACCTACTGCCCGCGCTGTGGAAGGCCCTTAATAGTCCGTTACGGCTTTGAGATTA CCGAGTACAACATAACTGAGGACGGAAGGTGTAAGTACTGCGGTGAGAAAATCCCGATAGTCGGCACCTACAAGAAAAAG CACTATCCTGGGATGTGGTG gtgagggtgatcgaagctatactctactttgaggcccttgggagaacgaggcttgcggt tgaggacagggtgagaaaaacctcccgtggactagaggggtccaggttggatgtaaagcggctcgaggtgggggaggtca ttgaggagccggaactcgatccccttcgcttttcggccctcctcgaggcgagggttgaggggggcctggaagatttggtc gaagttgttgctcgatatggcccaaccctcgttgagatcctcagaccgggcaggcttgaactccgtgccgaggacctctc caggcttttgctcgggctctcgagaacgattagtgatctggttgagggggatatccaggtaccggttccgctgagcctga aggagattccggttcctcaggtaggatttgacgaggaggagctctgggaaatgatctaccaggacaggggtattctatac gggctttcccttcgtctgcccgaggaaatcgcggaggataccctcttaaagctcctcctccttgagggctgcggcgtcaa cagtatcgaggctcgtgacctcgatggggggagcgagttcaggcttgaagtggtttctccctttgagtcgctcttcgcgg tggtgttcaagtacagacccttctcactgaatgtaatagaaccggaggtctttgacatcaccgcccctgagctccagaat gctctcagcgatcttggttcctttgttaactccctcctgatgggtgaggatcttcagaaggcctatgagagggacacttt ttccttcaaacttgtt TGAAAGCAGTCGAAAAGTATATGAGGTTGAAGGAGAAGGTAGGAGATGACGCAGGAGAATAAG GGGGTATGCTGATGAAAATACTTCGAAAAAACGTCACGAAGGTCTTTGCCCTCCTCCTGGGGGTTATGTTTCTCCTATCG ATCGGCGGTGCTTCAGCAGGCTCCAATTACATCGTCCCCACTGGCCTTAAGGACATCAGCAACGTTCCAAGGAGCTTTTT CGTCAAGCCTGACGGAACCCCCAACGTGAAGATAGTTGTGGGAAGCTACGCTAAGGCGGAGGATGTTGCCAGCGCCGCCG ATATAGCCGCTGCACTTGGGAGCGTGCTGTACAAGGAAGAGGAAGCCAAGAACATAGCCGTTAAATTGAGAAAAGCCGGT GAAACCGACGTTGCCCTTGAGCAGGTTATATACCGCTACGACTACGAAACCATGACCTCGGATCATAACCTGCCCTACAA CAGCGGCCTAGTGAACTGGTCAAAGTCTTATGATGA