tg0445

Coordinates:439030-439707

>tg0445 hypothetical protein TGAM_0445
MILSFLVVLMSKRYLLVTFVFILLLLGGFLIDSWYSAYTSLFRSDFPSKAMIQNEGVRVEGYLPGDPLDLVNATLYHHYE
RVTVILGSGDTKDYCDRTGKCQFRTLAAVEISCLVGKLMGSYYYETAREMGYNDSAARKFALDQVSRRVNSGNWLTFSLK
LAIGRGEIGNEKHLLIILRGPLDGAVENRIYVPRKGVLVLEALDDRTLYREALLVEGITGISCSKG

>tg0445 hypothetical protein TGAM_0445
gtgatcctttcctttttggtggtgctcatgagcaaaaggtaccttctggtgacttttgtttttatactccttctcctcgg
tgggttcctcattgactcctggtattccgcctacacgtccctttttcgatcggactttccatcaaaggccatgatccaga
acgagggagtgagagttgaaggctatctcccgggtgatccccttgatctcgtaaacgccaccctataccatcactacgag
cgagttacggtgatcctcggtagtggggacaccaaggactactgcgacaggactggaaagtgtcagttcagaacgctggc
cgccgttgagatctcatgtctcgttggcaagctcatgggttcgtactactacgagaccgcccgggagatgggatacaatg
actcggccgccagaaagtttgcccttgatcaggtttccagaagggtaaattccggtaactggcttacgttttcgcttaaa
ctggcaataggtcgaggagaaatcggaaatgaaaagcatctgctaataatccttagaggtcccctagatggggccgttga
gaacaggatttacgttccacgaaagggagtgctcgttctggaggcacttgatgatagaaccctttacagggaggcccttt
tggttgagggaataacgggaataagctgctcaaaaggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 438530 - 440207 (Additional range around tg0445 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGAGGTCCCTGAACGAGAAGGATGTTGACTTCGACATCAACCGCGATGGTAGCATAACCGACACCAGCTACGTCGTTGC CAAGGCTACCATCACGATCCTTGAAAACCACCCGAAGATCCACGAACTGGTTCTCTCGGTCGGGGACAGGATTCCGGGGA CGGACTACGTCATCTCGGGCGTTGGGGGCGTCAAGAACATCGTCCTGAAGACCCCAACCCAGCCCATAACGATCCTCGAC ACCGAAGTTAACTTCGTGAACCCGACCTCTAACTACATCCTCGTGGGATCCAACAAGGCAAACTTGCTCACCTCGATGAT CTTCGGCCACTACCACCTTCCCGTTGACTTCAGGGTCTGGTTCGGCGAATATCCGGTCCTCGGTTACATCCCGCACTGCG ACCTTCTCAAGGGCAGGAGCGTCATAATAGTGGCTGGTTCAACACCCAAGGCGACCAGAAAAGCCGCAACGATACTCATG CAGTACATAGCCGGCCTTTC gtgatcctttcctttttggtggtgctcatgagcaaaaggtaccttctggtgacttttgt ttttatactccttctcctcggtgggttcctcattgactcctggtattccgcctacacgtccctttttcgatcggactttc catcaaaggccatgatccagaacgagggagtgagagttgaaggctatctcccgggtgatccccttgatctcgtaaacgcc accctataccatcactacgagcgagttacggtgatcctcggtagtggggacaccaaggactactgcgacaggactggaaa gtgtcagttcagaacgctggccgccgttgagatctcatgtctcgttggcaagctcatgggttcgtactactacgagaccg cccgggagatgggatacaatgactcggccgccagaaagtttgcccttgatcaggtttccagaagggtaaattccggtaac tggcttacgttttcgcttaaactggcaataggtcgaggagaaatcggaaatgaaaagcatctgctaataatccttagagg tcccctagatggggccgttgagaacaggatttacgttccacgaaagggagtgctcgttctggaggcacttgatgatagaa ccctttacagggaggcccttttggttgagggaataacgggaataagctgctcaaaaggt TAGAGGAGTTACCACTCCTC CTCTTCTTCTCCGATGAGCCCGTACTTCTCGAGCTCGCGGAGGAGTTTCTTAACGGCTTCCCATGCGTCTTTCTCGCTCT TCGCACCCGAGCAGACGATCTTGCCTGAGGAGAAAAGCAGTATGACCGCCTTTGGATCCTTGGCACGGTATATGACGCCG GGGAACTGCTCCGGCTCGTACTCACAGTTTGGAAGGCTCAAAGCAACGGCATCGAGGTTAAACTCCATGCCGATATCACC GCTGAAGACCATGTTCTGTATGTCAATCTGGGGTGGCTTCGTGAACTTCGTTCCGACCTTCGTCTTCAGCATTTCGGTGA GCTTTTTGACGGCCCTCTCGATGTCTTCAACACTCTTGGCGCCGGTAACGACGAGTTTTCCCGAGCTGAATATCAGCAGG GCAACCTTTGGCTCGTCGAAGCGGCAGATGATTCCGGGGAACTCCTCTGGATTGTACTTCGAGTTGGGGCATATTTCAA