tg0450

Coordinates:443576-443911

>tg0450 Nucleotide binding protein, putative, containing PIN domain
MVPVINDIVFSEFLFHYIALKTGVSPFTIKKRGEIGKVILTEEPKDFLNQFHVLPTDDEVLEVSYGLIRKHNLLPNDAII
LATCLVFEVRNFGTLDSDLKQAGEKEGLNVLP

>tg0450 Nucleotide binding protein, putative, containing PIN domain
ttggtcccagtaatcaacgacatagttttcagtgagttcctttttcactacattgccctcaaaactggagtttccccgtt
tacaatcaaaaagcggggtgaaataggaaaagtaatcctcaccgaggaaccaaaggacttcctcaaccagtttcatgttc
tccctacggacgatgaggttcttgaggtatcttatgggctcataagaaagcacaatctgctcccgaatgacgcaataatc
ctcgccacttgtcttgtctttgaagtgagaaactttggaacgctggacagcgatcttaaacaggctggggagaaagaagg
actaaacgtccttccc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 443076 - 444411 (Additional range around tg0450 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTGCCGTCATTGTAATTCCTTCCAGCTCAACTTACAATCAAGGGCTTCCAGACAAACCGTTAGAGTTTGAATTTTTCGA TGAGAGGAAGCTCTTTATAGTTGCGTACAACATGGATTATGTAAAAACGGGTGCAATATTTAAGGCAGATAAAAACTTTA GAAGGAGCCTAAACAACATTATTGGCAAACTAAACACCTAAGTTATCTCAATGCTAAACTATAGCGCGGTGATACAATGG GCGAGATAGTTGTGAAAGTTCCCTCTGGAATGGAGCGCCTCATTGAACGGAAGATAAAGATTATACTTGAGCGGGAGATA AGGAAAGGGCTGAGCAGAGCTGTTCTTTCCAAGTACCTTGGCAAATTCAAAGGGGATGTCAATGAAGAGGACTGGTACCT CCAGTGAGCTTATCTTTTTGGACTCCTCCGTTTTAATCGAAAGGACTAAAAGGTAATCCCTCCGCCGTTTCGCTTTTTGA GGAGCTCCTCAACTCCAAT ttggtcccagtaatcaacgacatagttttcagtgagttcctttttcactacattgccctc aaaactggagtttccccgtttacaatcaaaaagcggggtgaaataggaaaagtaatcctcaccgaggaaccaaaggactt cctcaaccagtttcatgttctccctacggacgatgaggttcttgaggtatcttatgggctcataagaaagcacaatctgc tcccgaatgacgcaataatcctcgccacttgtcttgtctttgaagtgagaaactttggaacgctggacagcgatcttaaa caggctggggagaaagaaggactaaacgtccttccc TAAACCTCCTCGAACTCCCACTCCTCCTTCTCTCTCCTCTTCT CGGCCTTCCTTCTGAGCTCTTCAGCCTTCGTTCTCTTCGGGGGGTGGAAACCCTTAAGCTTCTCAAAGCTTCCCCAGAGG CGCATTAACTCTTCCCAGACCTCGGAATCTGGGGGGATTACAAGGATATGGGCCGGGGGATGAATGTCCATCAGCCTGCC TATGGCCTTCTTCGGCGGAAGGTCAATCTGGGCAACGACGTGGGCTTTAAAGCGCTTTCTCGGTTTCTCGCCACTTATCT TTTCGAAGGCCCAGTCTGAGAGGGCAGGCGGTATTATCCTCGGGTCACCGCGAATTCTCATACCCCCGTACCTCACGAGG TCAGCTAAAGCAACGCTCGCCTTCTGAAAGTTGTCGGTTCTAACTAAGACAATCGTGTTTCTCATACTCTCACCAAGGAA TGAACGATTGAGATACTTATAAACCTGATCGAAAGCAAAGCTTTAAGTATCAGGAAG