tg0451

Coordinates:444007-444174

>tg0451 hypothetical protein TGAM_0451
MGEIVVKVPSGMERLIERKIKIILEREIRKGLSRAVLSKYLGKFKGDVNEEDWYLQ

>tg0451 hypothetical protein TGAM_0451
atgggcgagatagttgtgaaagttccctctggaatggagcgcctcattgaacggaagataaagattatacttgagcggga
gataaggaaagggctgagcagagctgttctttccaagtaccttggcaaattcaaaggggatgtcaatgaagaggactggt
acctccag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 443507 - 444674 (Additional range around tg0451 is :500nt.)

>Thermococcus gammatolerans EJ3 TTATTGAGAGAGTTCTCGTGAGAAACCTTCCGCCGGAATACAAATTGTTCTACCAAGAATCTTATCCATTTTTAAAAAAT CAGAATGGAAGCTCCCAAAAGCCTGATTACGTTGTTAGAAAAGGTAACACTCCTGTTGTAGTTCTTGATGCAAAATACAG AGAGCTCAAAGAGAGAATCCCCAGCTCGGATATGTTACGCCAGCTTTATGTCTATTCACGGATTTGGGGTTATAAGACCA GTCACGAAAATGACTCAAAACCTCCTGCCGTCATTGTAATTCCTTCCAGCTCAACTTACAATCAAGGGCTTCCAGACAAA CCGTTAGAGTTTGAATTTTTCGATGAGAGGAAGCTCTTTATAGTTGCGTACAACATGGATTATGTAAAAACGGGTGCAAT ATTTAAGGCAGATAAAAACTTTAGAAGGAGCCTAAACAACATTATTGGCAAACTAAACACCTAAGTTATCTCAATGCTAA ACTATAGCGCGGTGATACA atgggcgagatagttgtgaaagttccctctggaatggagcgcctcattgaacggaagata aagattatacttgagcgggagataaggaaagggctgagcagagctgttctttccaagtaccttggcaaattcaaagggga tgtcaatgaagaggactggtacctccag TGAGCTTATCTTTTTGGACTCCTCCGTTTTAATCGAAAGGACTAAAAGGTA ATCCCTCCGCCGTTTCGCTTTTTGAGGAGCTCCTCAACTCCAATTTGGTCCCAGTAATCAACGACATAGTTTTCAGTGAG TTCCTTTTTCACTACATTGCCCTCAAAACTGGAGTTTCCCCGTTTACAATCAAAAAGCGGGGTGAAATAGGAAAAGTAAT CCTCACCGAGGAACCAAAGGACTTCCTCAACCAGTTTCATGTTCTCCCTACGGACGATGAGGTTCTTGAGGTATCTTATG GGCTCATAAGAAAGCACAATCTGCTCCCGAATGACGCAATAATCCTCGCCACTTGTCTTGTCTTTGAAGTGAGAAACTTT GGAACGCTGGACAGCGATCTTAAACAGGCTGGGGAGAAAGAAGGACTAAACGTCCTTCCCTAAACCTCCTCGAACTCCCA CTCCTCCTTCTCTCTCCTCTTCTCGGCCTTCCTTCTGAGCTCTTCAGCC