tg0455

Coordinates:448080-448547

>tg0455 N-acetyltransferase
MTKVKIEKLQKLDQETLERLIEIYMNAYEGMREYGGEGESYAKRYLRWCWSKAKDGFFVAKIGDKIVGFIVCDDDWYSRY
EGRTVGAIHEFAVDKSYQGHGIGRKLMEKCLEYLGGKDIELWVGEKNERAKRFYEEYGFREVGKHGIWVRMVRRKR

>tg0455 N-acetyltransferase
atgacgaaagtaaagatagagaaactccaaaagctcgaccaggaaacccttgagaggctgatagagatttacatgaacgc
ctacgagggaatgcgcgagtacggcggggaaggggagagctacgcgaagcgctacctgaggtggtgctggagcaaagcta
aggacggcttcttcgtcgccaaaatcggcgacaagatagtcggcttcatcgtctgcgacgacgattggtacagcaggtac
gaggggagaaccgtcggggccatacacgagttcgcggtggacaaaagctaccaggggcatgggatagggcggaagctcat
ggagaagtgccttgaatacctcggcggaaaagatattgagctctgggtcggtgagaagaacgagcgggcgaagaggtttt
acgaggagtacggtttcagagaggtcggaaagcacggcatctgggtgaggatggttagaaggaaaagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 447580 - 449047 (Additional range around tg0455 is :500nt.)

>Thermococcus gammatolerans EJ3 CGATGAGCGTAATCTTGAAGTAGCGCTCGAGCTTCTTGGCCTCCTTAATCGTTGGCTCGCGGTAGCCGTGCGCTATGGCC CTCAAATCGTTCACCGAAAGCCCAATCTCATGGGACAGCTCCTCGTAGCTCTTACCGCTCCTCTGTATGGCCCTGTAAAC CCTCTCGGCGAAGTCCTCGACTATCTCCTCGGTGTAAAGCGGTCTCTCACGGTAGGGCTTTGGCTCCCTCTTCGGCCTCG GTGCTGAGACGGGCCTTCTCCTCGGCTCCCTTCCTGTGGGCATTATGCTGAAGCCGGACTTCTTTCGGCCGTACTTCTCG TAACAGCGGTCGCAGACGAGAACCTCGGCACCTTCGAGCCTTATCCTGTGGCCCGGGCCCCTTATGGGTGCACCACAAAT CTCGCAGTAGCGCGGCTTGGCCTTGCTCATAGCTACCACCTTCTCTACCGCTCAAAGCTCGGAGTCAGGCTTTTTAAACC CGACGATGAGGATATCAATG atgacgaaagtaaagatagagaaactccaaaagctcgaccaggaaacccttgagaggct gatagagatttacatgaacgcctacgagggaatgcgcgagtacggcggggaaggggagagctacgcgaagcgctacctga ggtggtgctggagcaaagctaaggacggcttcttcgtcgccaaaatcggcgacaagatagtcggcttcatcgtctgcgac gacgattggtacagcaggtacgaggggagaaccgtcggggccatacacgagttcgcggtggacaaaagctaccaggggca tgggatagggcggaagctcatggagaagtgccttgaatacctcggcggaaaagatattgagctctgggtcggtgagaaga acgagcgggcgaagaggttttacgaggagtacggtttcagagaggtcggaaagcacggcatctgggtgaggatggttaga aggaaaagg TGATAAGTGAGAAGGAAAAGTTGTTTTATCGGTGGTTGCAATGCCGTGCATTCATCCGCCAAGTCCCGAC AAGGTGAGGAACATGAAGGAAGAGAGCTTCATAAGGGAAGGAAAGGGAAAGCTGAAGGTCACAATAGAGGGGAGCGAGAC CCTCGAAACTACGATGAGCGGAAGGCTGAAGAGCGTTGAGGAAGTTGCCGAGATGCTCGGCGTCGAGGCCAAGAACGGGA AGATAGACGCGGTGGTTGATGGAGTGAAGGTTCGGATGGAGAAAGGGAAGCTCGAGCTTGAGTTTGAGAGCGGGGACAGG ATGAGGATTGAGAGGGCTTAGCTTTCAATTATTATTGCGTCTCCCAAGAGCCGAAAATGGTAGTCGGTCGTAACTACGAG CGCTCCATACCTCTTAGCAGTTTTGGAGATAATGCAATCTGCGAGTGAAACGTGCTTGTTTTTGTTCTTTCTGCGTATTT CTGCGTGCAGTTTCCCCGCGTTGATTGCC