tg0463

Coordinates:452968-453645

>tg0463 Fibrillarin pre-rRNA splicing protein (flpA)
MKVKKHRFPGVYIVIDDDGSEKIATKNLVPGQRVYGERVIKFEGEEYRIWNPSRSKLGAAILNGLKNFPIKPGSTVLYLG
IASGTTASHVSDIVGWEGKIFGVEFSPRVLRELVPIVEERRNIVPILGDATKPEGYRALVPKVDVIFEDVAQPTQAKILI
DNAKVFLKSGGYGMISVKSRSIDVTKEPEEVFKEVERELASYFEVVERLSLEPYEKDHALFVVRKP

>tg0463 Fibrillarin pre-rRNA splicing protein (flpA)
atgaaggttaagaagcacaggttcccgggcgtttacatcgtcatcgatgacgacgggagcgagaagattgcaaccaagaa
cctcgttcccggccagagggtttatggggagagagttatcaagttcgagggcgaggagtacaggatttggaatccaagca
gatcaaagcttggagcggcgatactcaacggcctcaagaacttcccgattaagcccggctcaacggtgctctaccttgga
atagcgagcggaaccaccgcttcccacgtcagcgacatcgtcggctgggagggcaagatattcggcgtcgagttctcgcc
gagggttctcagggagctcgttccaatagtcgaggagaggaggaacatcgtcccgatactcggcgacgctaccaagcccg
aaggttaccgcgcactcgttccgaaggttgacgtcatcttcgaggacgtcgcccagccgactcaggcgaaaatcctcata
gacaacgccaaggtgttcctcaagagcggtggctacggaatgatttctgtcaagagcaggagcatcgacgtcaccaagga
gcccgaggaggtcttcaaggaggtcgagagggaactcgcgagctacttcgaggtcgttgagaggctttcgctcgagccct
acgagaaggaccacgctctcttcgtcgttagaaagcct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 452468 - 454145 (Additional range around tg0463 is :500nt.)

>Thermococcus gammatolerans EJ3 TGGTCGGTGCGAAGCTTGCCGCTCGCTTGATGAGCCTCGCTGGAGGCCTTAAGGAGCTCGCCATGATGCCCGCTTCAACG ATACAGGTTCTTGGAGCCGAGAAGGCCCTCTTCAGGCACCTAAGGACGGGCGCCAAGCCGCCAAAGCACGGCGTCATCTT CCAGTACCCTGCAATAAACCGCTCGCCCTGGTGGCAGAGGGGTAAGATTGCGAGGGCTTTAGCTGGAAAGCTGGCCATAG CGGCTCGCGTTGACTACTTCTCTGGTGAATACATCGGTGAGGAGCTGAAGAAGGAGCTCGAGCAGAGAATCAAGGAAATC AAGGAGAAGTACCCGAACCCGCCCAAGAGGAAGGCCAAGCCGGAGAAGAAGAAAAAGAAGAAGTTCAAGGGCAAGGAAAA GAAGGGCAAGAAGCACGAAAAGGGCAGGAAGGAGAAGAAGGGTAAAGGCAAGCCCGATAAGAAGGGTAAGAAGAAAAAGA AGGGCAAGAGGTGAGGTAG atgaaggttaagaagcacaggttcccgggcgtttacatcgtcatcgatgacgacgggagc gagaagattgcaaccaagaacctcgttcccggccagagggtttatggggagagagttatcaagttcgagggcgaggagta caggatttggaatccaagcagatcaaagcttggagcggcgatactcaacggcctcaagaacttcccgattaagcccggct caacggtgctctaccttggaatagcgagcggaaccaccgcttcccacgtcagcgacatcgtcggctgggagggcaagata ttcggcgtcgagttctcgccgagggttctcagggagctcgttccaatagtcgaggagaggaggaacatcgtcccgatact cggcgacgctaccaagcccgaaggttaccgcgcactcgttccgaaggttgacgtcatcttcgaggacgtcgcccagccga ctcaggcgaaaatcctcatagacaacgccaaggtgttcctcaagagcggtggctacggaatgatttctgtcaagagcagg agcatcgacgtcaccaaggagcccgaggaggtcttcaaggaggtcgagagggaactcgcgagctacttcgaggtcgttga gaggctttcgctcgagccctacgagaaggaccacgctctcttcgtcgttagaaagcct TGAGACTTTCTTTTTGAACTT TTAGGCCCTTTAAATTTTGAAAAAGGAAATCGGGGCATCAACCCCTTTTTGGTAGGTGCGGGATTATCCAGCTCAGGAAA CCATCCATACTCCTCGTCTGTATGTACAGAGTTCCGGTGCCATAGAATTCGGCAACAAGCCCTTCTCCGCTGAGGAGAGT GCTCTTCAGTCCGCCGACCCGCTTCACTGTAAAGTCCAGACCCTCGCTGAAGGCCACGAGGTGTCCTGTGTCTATGATAA AGCGCTCGTTGTGAAGTTCCTTTCTGACTATGGCCCCGAAGCTTGAGAGGAACACCGTGCCCCTTCCGCTCATCTTGAGC AGGAACAGTCCTTCCCTGCCAAAGAACGTTTTTGCCCCTCCCCATTTCGTGTCTATGTCTATCTCCCCACTGCTTGCAAG AAAGGCACCGCTCTGCGCGTAAAGCGTTCCATCGAGCTCAAAGGCCTCTATGTCCCCAGGATACGGTGGGGCAAGCCCT