tg0475

Coordinates:463690-464598

>tg0475 Transcription initiation factor TFIIB (tfb)
MADKRVCPVCGSTEFFFDRTRGELVCRVCGYVLEENVVDEGPEWRAFDPDQRARRARTGAPMTLMIHDKGLSTDIDWRDK
DIHGNQITGMYRSKLRRLRMWQRRMRINDAAERNLAFALSELDRMAAQMRLPRRVKEAAAALYRKAVMKKLIRGRSIEGM
VSAALYAACRMEGIPRTLDEIARVSKVTKKEIGRSYRFMARGLGLNLRPTSPIDYVDRFGDALGVSSKTKQRAKEILQEA
IKRGITSGKGPTGLAAAALYVASLLEGEKKTQREVAEVAHVTEVTVRNRYKELVEKLNIKVPM

>tg0475 Transcription initiation factor TFIIB (tfb)
ttggccgataagagggtgtgtccggtttgtggttcaacggagtttttctttgacagaacgcggggagagctcgtctgccg
ggtctgcggttatgtgcttgaggagaacgtcgttgatgaagggccggagtggagggccttcgatcccgaccagagggcga
ggcgcgcgagaactggtgcgcctatgacacttatgatacacgataagggcctctcgaccgatatagactggcgcgacaag
gatattcatggcaatcaaataactggcatgtacaggagcaagctcagaaggctccgcatgtggcagcggaggatgcgcat
aaacgacgccgccgagaggaacttggcgttcgcgctgagcgagctcgacagaatggcggcccagatgaggctcccaaggc
gcgtgaaggaagctgccgctgccctttaccgcaaggccgttatgaagaagctcatccgcggacggtcaattgagggcatg
gtttcagctgctctgtacgcggcctgcaggatggagggcattcccagaacccttgatgagatagccagggtttcgaaggt
cacgaagaaggaaatcggaaggagttatcgctttatggccaggggtctgggcctgaacctccgcccgacgagcccgatcg
attacgtcgataggtttggtgatgccctcggtgtgagctccaagaccaagcagcgtgccaaggagatcctccaggaggca
ataaagaggggcattaccagtggtaagggcccgacggggctcgcggcggctgctctgtacgttgcctctctcctcgaggg
agagaagaaaacccagcgtgaggttgcggaggttgcccacgtcaccgaggtcaccgtgagaaatcgctataaggaactcg
tcgagaagctcaacatcaaggttccgatg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 463190 - 465098 (Additional range around tg0475 is :500nt.)

>Thermococcus gammatolerans EJ3 GCTAAAAAGTGCCTTTTTAAAACATTTTCTTGACATTTTTTTGTTTAATAGATTAATCGGGGGTTTCTGGAAAAGAGGAA TTTGAATTTAACTTCTAGATCACTCCCAAATAAAAGCCTTTCGGAAGTGACCGAAAAGCTTATAAATGATTTGAGCGAAA AGTTTAAAAGGATATGGCCTTTTGGGGTGGGGCTATGAAGCGGCTCGGGAGAGTTTCTCACTATGCAAAGCAGGGGTTTC TGATAATCAGGACGAACTGGGTACCCAGTTTGAACGATCGTGTCGTTGACAAAGATCTCACCTTTGTTGGTATCATCAAG GATGTTTTTGGTCCCGTGAAGGCACCTTTTGTTGCAGTAAAACCCAGAGTAAAGAAGCCCGAAAGCTACGTGGGCTCTGT TCTGTACGTTGATAATCGAAACAGGAAAAAAGGAAAGGAAACTCGGCCCAAAAAGAGGCGTTCGAGACGCCCCACCCCCA AGAGAAGGGGGTGAGAACCT ttggccgataagagggtgtgtccggtttgtggttcaacggagtttttctttgacagaac gcggggagagctcgtctgccgggtctgcggttatgtgcttgaggagaacgtcgttgatgaagggccggagtggagggcct tcgatcccgaccagagggcgaggcgcgcgagaactggtgcgcctatgacacttatgatacacgataagggcctctcgacc gatatagactggcgcgacaaggatattcatggcaatcaaataactggcatgtacaggagcaagctcagaaggctccgcat gtggcagcggaggatgcgcataaacgacgccgccgagaggaacttggcgttcgcgctgagcgagctcgacagaatggcgg cccagatgaggctcccaaggcgcgtgaaggaagctgccgctgccctttaccgcaaggccgttatgaagaagctcatccgc ggacggtcaattgagggcatggtttcagctgctctgtacgcggcctgcaggatggagggcattcccagaacccttgatga gatagccagggtttcgaaggtcacgaagaaggaaatcggaaggagttatcgctttatggccaggggtctgggcctgaacc tccgcccgacgagcccgatcgattacgtcgataggtttggtgatgccctcggtgtgagctccaagaccaagcagcgtgcc aaggagatcctccaggaggcaataaagaggggcattaccagtggtaagggcccgacggggctcgcggcggctgctctgta cgttgcctctctcctcgagggagagaagaaaacccagcgtgaggttgcggaggttgcccacgtcaccgaggtcaccgtga gaaatcgctataaggaactcgtcgagaagctcaacatcaaggttccgatg TGAGGTGTTTCTTTTTGAGGGTTGCCGTT CTCAGCGATACCCACGTTGGGGACAAAGCGAGGGCCCTCCCTCCCGTTCTTATTGAGAAAATGCGCAACGCCGAACCCGA ACTTATCCTCCACGCGGGGGACGTGACAGATCCGTCCGTTCTGGAGACGCTTGAGGAAATCGCCCCTGTCGTCGCCGTTA GGGGAAACGTCGATTATCTACGCCTTCCGGAGGAAGAAACTGTTGAGATAGATCGGATAAGGATAGGCCTGATACACGGA CACCAGCTTCTCTCACTTAACGCACAGTTTTTGACATTGAAGGCCCTTGATATGGGGGTTGACCTGCTTGTGTTCGGCCA CACACATCGCTTTTACTTTGACACCTTCAGCCTCTATGGGAGAAAGGTCTACCTGTTAAACCCCGGCTCCCCCACGTTTC CCCGGTGGGATAATGCGGGATTTGTTCTTCTGAGAACTGGTGAAGAGATCTTGGTTAAAAGGATAAAGCT