tg0478

Coordinates:465524-465703

>tg0478 hypothetical protein TGAM_0478
MKRAQAAVEYLLMIAVALMMVAIVVKYVREAAERAGKTINESSKTLSEYLQKEWSNVRGS

>tg0478 hypothetical protein TGAM_0478
atgaagcgggcccaggcggccgttgagtacctcctgatgatcgcggtggccctgatgatggtcgcaatagttgtcaagta
cgttagagaggctgcagaacgggcaggcaaaaccatcaacgagtcctcaaagaccctttccgagtacctgcagaaagagt
ggagcaatgtgcgcggtagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 465024 - 466203 (Additional range around tg0478 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGGCCTTGCGGTAGTTTCTTCTGAGTTTCTGGATGATCTTATCAACGTTATCGGTCTCGATAACGCTCTCCCTAACGGC CTTTTCGGCAACGCGAAGGCCTTTATCTATTCTCCTCCTGATGTCGTCTATTAGTTCGTACACCACAAAGGCGGGAATCT TTATATCGTGAACGTTCGGGGGCTTCTTTATGATGTAGAGCTCGAGCTCAGGCGATAGATCCTCCTCGTCCACGAAGTTC ATGACCTCCCGGTATATTCCGGGAGGCATGTAAAACTCCACCTTGCCGAAGAGGACTTTGGCGTATTCGAGAAAGGACCT AACTGCCTCGGTTGGGTTCTCCCCGAAGGAGGATCTGATGTCAGGGTTGACAAAAATGCTTGTATCGAGAACGAACCTCA TGATTACCCCCAATCTGGTACGCAATTCATATTAAAAACCGTTGTGGGTAACCAAAGGGTTTAATAGAAGGTTTACCAAA CTTATTAAGGGGTGAGAGC atgaagcgggcccaggcggccgttgagtacctcctgatgatcgcggtggccctgatgatg gtcgcaatagttgtcaagtacgttagagaggctgcagaacgggcaggcaaaaccatcaacgagtcctcaaagaccctttc cgagtacctgcagaaagagtggagcaatgtgcgcggtagc TGAACCAGAAGTTTATGTTTTCCCATTTTAACAATTTAA GCATATGGTTTTCTCTATATTAACCTCGATGACATGTAGCGATCTATCCAGTGATTCAAGGGTTCTTACGCGTCCGATCC CGAAAACTTTATATAGGGCGTTAGGCCTAAAATAAAGTGCAAAAGACTCCTATACAACTTGATGGAGGTGTATGAAATGG CCGAGTTGCCAATTGCCCCGGTTGACAGGCTTATAAGGAAGGCCGGTGCTGCCCGCGTCAGTGAGGAAGCCGCCAAGGTT CTCGCCGAGCACCTTGAAGAGAAGGCCATTGAGATCGCCAAGAAGGCCGTCGAGCTTGCCCACCACGCCGGCAGGAAGAC CGTCAAGGCCGAGGACATCAAGCTCGCCATCAGGAGCTGATGCCCCTTTCCTGTTCTCTTTTACCAGAGCTTTATCCTTT TAACCAAGATCTCTTCACCAGTTCTCAGAAGAACAAATCCCGCATTATCCCACCGGGGAAA