tg0486

Coordinates:472421-472915

>tg0486 LSU ribosomal protein L11P (rpl11P)
MPQVVEVLVEGGKASPGPPLGPAIGPLGLNVKQVVDEINKATKEFEGMQVPVKIIVEDPKKKTFRIEVGIPPTSQLIKKE
LGIPKGSSEPVHSPVGNLTMEQVIKIAKMKIDQMLAPTLKAASKEVIGTALSMGVTVEGKDPREVQREIDEGLYDELFAK
AEEAE

>tg0486 LSU ribosomal protein L11P (rpl11P)
ATGCCACAGGTCGTTGAAGTCCTCGTTGAGGGAGGAAAGGCCTCACCCGGACCCCCACTTGGTCCGGCAATTGGTCCACT
TGGATTAAACGTCAAGCAGGTCGTCGATGAGATAAACAAGGCAACCAAAGAGTTCGAGGGAATGCAGGTTCCCGTTAAGA
TCATCGTTGAGGATCCCAAGAAGAAGACCTTCAGGATTGAAGTCGGTATCCCGCCCACAAGCCAGCTCATCAAGAAGGAA
CTCGGCATCCCCAAGGGTTCAAGCGAGCCCGTCCACAGCCCGGTTGGGAATCTGACAATGGAGCAGGTCATAAAGATAGC
CAAGATGAAGATCGACCAGATGCTCGCTCCGACCCTGAAGGCTGCTTCGAAGGAGGTCATAGGCACAGCCCTCAGCATGG
GAGTCACCGTCGAGGGCAAGGATCCAAGGGAAGTCCAGAGAGAGATCGACGAGGGCCTTTACGATGAGCTCTTTGCCAAG
GCAGAAGAGGCCGAA


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 471921 - 473415 (Additional range around tg0486 is :500nt.)

>Thermococcus gammatolerans EJ3 GATGGTGGTTCCCATGAGCGAGGGCAAGATATTCACAGTGAGGGTCACGGTTGGTCAGGAAGAGACCACCGCGAAGCTGA TCTACAGCAAGGTTAAAACTTACAACCTGCCTGTTTATGCCATCCTCGCTCCAAGCAAGGTTAAGGGTTACATCTTCGTT GAGGCCCCCAGCAAAAGCGCCGTGGACGAGGCAATAAAGGGCATCAGGCACGCTAGGGGGACTCTGCCCGGCGAGGTCAA GTTCGAGGAGATAGAGCACTTCCTTGAGGAGAAGCCAGCTGTGAGTGGCTTCGAGCCCGGCGATATAGTTGAACTCATCT CGGGCCCGTTCAAGGGGGAGAAGGCCAAGGTCGTTAGGGTCGATGAGAGCAAGGATGAGATAGTCGTTGAGCTCATCGGT GCAATAGTCCCGATCCCCGTTACCGTGAGGGGAGAATACGTTAGACTTATAAGCAAGCACCAAAAGGAGTGAACGGTTTA CAGGTTGAGAGGTGAGAACG ATGCCACAGGTCGTTGAAGTCCTCGTTGAGGGAGGAAAGGCCTCACCCGGACCCCCACT TGGTCCGGCAATTGGTCCACTTGGATTAAACGTCAAGCAGGTCGTCGATGAGATAAACAAGGCAACCAAAGAGTTCGAGG GAATGCAGGTTCCCGTTAAGATCATCGTTGAGGATCCCAAGAAGAAGACCTTCAGGATTGAAGTCGGTATCCCGCCCACA AGCCAGCTCATCAAGAAGGAACTCGGCATCCCCAAGGGTTCAAGCGAGCCCGTCCACAGCCCGGTTGGGAATCTGACAAT GGAGCAGGTCATAAAGATAGCCAAGATGAAGATCGACCAGATGCTCGCTCCGACCCTGAAGGCTGCTTCGAAGGAGGTCA TAGGCACAGCCCTCAGCATGGGAGTCACCGTCGAGGGCAAGGATCCAAGGGAAGTCCAGAGAGAGATCGACGAGGGCCTT TACGATGAGCTCTTTGCCAAGGCAGAAGAGGCCGAA TGAGGCCTCTTCTCTCCGAATTTAGGGGTCATGGAAAAGTTTA AAAACTCATTCCTTTACGCATCTTTGATTCTTCGTCCTTGCTAAAATCAAAAAAGAAAGGGAGGGCTGTAAAGTGGCCTT CGACAGGCAGAAAGTCGTGGAAGCGGTGAAGGAGGCGAAGGCCCGGGCCAAGCCGCGTAACTTCACACAGACCGTCGAGA TGGCAGTCAACCTCAAGGATATAGACCTCCGCAAGCCGGAGAACAGGTTTAAGCTTGAGGTTGTACTGCCTCACGGTCGT GGGAAGGAGCCCAAAATCGCGGTCATCGCTGATGGTGCCGTTGCCGAGGCGGCTAAAAGGCTCGGGCTTGATGTGATTAG TGGTGAACAGCTTGAGGAACTCGCGAAGAGCCCGAGGGAAGCGAGAAAGCTGGCGAAGCGCTATGACTTCTTCATTGCCG CGGCTCCGCTGATGCCCAAGATAGGTAGGTACCTCGGTAGGTACCTTGGTCCGAGG