tg0487

Coordinates:473031-473678

>tg0487 LSU ribosomal protein L1P (rpl1P)
MAFDRQKVVEAVKEAKARAKPRNFTQTVEMAVNLKDIDLRKPENRFKLEVVLPHGRGKEPKIAVIADGAVAEAAKRLGLD
VISGEQLEELAKSPREARKLAKRYDFFIAAAPLMPKIGRYLGRYLGPRNKMPQVVPPTLTNLEPIVNRLKKTVRIQLKNN
PVVHAPIGTEDMDDEKLAENAEAVLNAIINKLERGENQVKSVYIKTTMGPAVKVER

>tg0487 LSU ribosomal protein L1P (rpl1P)
gtggccttcgacaggcagaaagtcgtggaagcggtgaaggaggcgaaggcccgggccaagccgcgtaacttcacacagac
cgtcgagatggcagtcaacctcaaggatatagacctccgcaagccggagaacaggtttaagcttgaggttgtactgcctc
acggtcgtgggaaggagcccaaaatcgcggtcatcgctgatggtgccgttgccgaggcggctaaaaggctcgggcttgat
gtgattagtggtgaacagcttgaggaactcgcgaagagcccgagggaagcgagaaagctggcgaagcgctatgacttctt
cattgccgcggctccgctgatgcccaagataggtaggtacctcggtaggtaccttggtccgaggaacaagatgccacagg
tcgttccgccgaccctgaccaacctcgagcccatagtcaacaggctcaagaagaccgtcaggatacagctcaagaacaat
ccggttgtccacgctcctattggaactgaggacatggacgacgagaagttagcggagaacgccgaggcggttctcaacgc
catcatcaacaagcttgagcgcggcgagaaccaggtgaagtcagtgtacatcaagaccacaatgggaccggccgttaagg
ttgagagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 472531 - 474178 (Additional range around tg0487 is :500nt.)

>Thermococcus gammatolerans EJ3 GATAAACAAGGCAACCAAAGAGTTCGAGGGAATGCAGGTTCCCGTTAAGATCATCGTTGAGGATCCCAAGAAGAAGACCT TCAGGATTGAAGTCGGTATCCCGCCCACAAGCCAGCTCATCAAGAAGGAACTCGGCATCCCCAAGGGTTCAAGCGAGCCC GTCCACAGCCCGGTTGGGAATCTGACAATGGAGCAGGTCATAAAGATAGCCAAGATGAAGATCGACCAGATGCTCGCTCC GACCCTGAAGGCTGCTTCGAAGGAGGTCATAGGCACAGCCCTCAGCATGGGAGTCACCGTCGAGGGCAAGGATCCAAGGG AAGTCCAGAGAGAGATCGACGAGGGCCTTTACGATGAGCTCTTTGCCAAGGCAGAAGAGGCCGAATGAGGCCTCTTCTCT CCGAATTTAGGGGTCATGGAAAAGTTTAAAAACTCATTCCTTTACGCATCTTTGATTCTTCGTCCTTGCTAAAATCAAAA AAGAAAGGGAGGGCTGTAAA gtggccttcgacaggcagaaagtcgtggaagcggtgaaggaggcgaaggcccgggccaa gccgcgtaacttcacacagaccgtcgagatggcagtcaacctcaaggatatagacctccgcaagccggagaacaggttta agcttgaggttgtactgcctcacggtcgtgggaaggagcccaaaatcgcggtcatcgctgatggtgccgttgccgaggcg gctaaaaggctcgggcttgatgtgattagtggtgaacagcttgaggaactcgcgaagagcccgagggaagcgagaaagct ggcgaagcgctatgacttcttcattgccgcggctccgctgatgcccaagataggtaggtacctcggtaggtaccttggtc cgaggaacaagatgccacaggtcgttccgccgaccctgaccaacctcgagcccatagtcaacaggctcaagaagaccgtc aggatacagctcaagaacaatccggttgtccacgctcctattggaactgaggacatggacgacgagaagttagcggagaa cgccgaggcggttctcaacgccatcatcaacaagcttgagcgcggcgagaaccaggtgaagtcagtgtacatcaagacca caatgggaccggccgttaaggttgagagg TGAGGGAGATGGCCCACGTAGCCGAGTGGAAGAAGAAAGAAGTGGAAGAG CTTACCAAGATCATCAAGAGCCACCCAGTGATTGCCCTAGTTGACGTGGCCGGTGTCCCCGCTTATCCGCTCAGCAAGAT GCGTGACAAACTCCGCGGGAAGGCTCTCCTCAGGGTCAGCAGGAACACCCTCATCGAGCTGGCCATAAAAAGGGCCGCTC AGGAGCTCAACAAGCCTGACCTCGAGAAGCTCGCCGACTACATCGAGGGCGGTGCTGCCATACTCGCCACCGAGATGAAC CCGTTCAAGCTCTACAAGCTCCTCGAGGAGAGCAAAACCCCAGCTCCTGCAAAGCCAGGGGCAGTCGTTCCAAAGGACGT TGTTATTCCTGCAGGACCGACTTCCCTTGCGCCGGGTCCGTTAGTCGGTGAGATGCAGGCCCTTGGAATTCCAGCGAGGA TTGAGAAAGGTAAGGTCACCATACAGAAGGATTACACCGTTCTCAAGGC