tg0489

Coordinates:474787-475104

>tg0489 LSU ribosomal protein L12A (rpl12A)
MEYVYAALLLHAAGKEINEENLKKVLEAAGVSPDEARIKALVAALEGVNIDEVIEKAAMPVAAPVAVAAAPAPAEGGAEE
AQEEEEEEEEEVSEEEALAGLGALFG

>tg0489 LSU ribosomal protein L12A (rpl12A)
atggagtatgtgtatgccgctctgctgctccacgccgctggtaaggagataaacgaggagaacctcaagaaggtgcttga
ggccgccggtgttagcccagatgaggccaggataaaagccctcgttgccgcccttgagggtgtcaacatcgacgaggtca
ttgagaaggccgccatgccggtcgccgctccggtcgcggtcgccgccgctcctgcccctgcagagggcggtgccgaggag
gcccaggaggaagaagaggaggaagaagaggaggtcagcgaggaggaggccctcgctggtctcggtgccctcttcggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 474287 - 475604 (Additional range around tg0489 is :500nt.)

>Thermococcus gammatolerans EJ3 ACTCCGGACGTTCTCGCGATAGACGAGCAGGAGTACATCAACATGCTCCAGCAGGCCTACATGCACGCTTTCAACCTGTC GGTTAACACCGCCTATCCGACCAAGCAGACCATCGAGGCCATCATCCAGAAGGCTTATCTTGGAGCCAAGAACGTCGCGG TCGAGGCCGGTTACATCACACCTGAGACCGTCGAGGACATCCTTGGCAGGGCGATACGTGCTTTCCTGCTCATAGCACAG AACCTGCCCGAGGAGTTGCTCGATGAGAAGACCAAAGAGCTTTTAAATGCTCAAGCCCAAGTGGCCGTTGCGGCCCCTCA GCCAGCTGAGGAGAAGGTTGAGGAGGCCGAGGAGGAAGAGGAAGAAGAGGAGGAAGCAAGCGAGGAGGAGGCCCTCGCTG GACTGGGCGCCCTCTTCGGCTGAAACTTTCAATTTCCCTCGTATCCTGTGGATCCATGTGAAATGGATGAAAAAATGAAG ATGATTGGAGGTGTGAAAAG atggagtatgtgtatgccgctctgctgctccacgccgctggtaaggagataaacgagga gaacctcaagaaggtgcttgaggccgccggtgttagcccagatgaggccaggataaaagccctcgttgccgcccttgagg gtgtcaacatcgacgaggtcattgagaaggccgccatgccggtcgccgctccggtcgcggtcgccgccgctcctgcccct gcagagggcggtgccgaggaggcccaggaggaagaagaggaggaagaagaggaggtcagcgaggaggaggccctcgctgg tctcggtgccctcttcggc TGAACTCCTCCCATTTTCTTTACTTTCTGACCCTTCTCTTTGAGAGCGCTATTCTCCTGC TCCCCTGATAGTTTCCGCGGTAGGGCCTTTTTGCAGGTTCTTCAAGCCTTATAAACGCTATCTGAACGAACCTTTCCCCG TATTCCAGAACGACTGGTTCGTTCGATGCGTTGAAAAGCATGAGCGTAAGATTGCCGTCCCATCCAGGGTCGACCCACGC GAACGAGCCGAGTATCCCCTCTCTTGCCAAACTGCTCCTTATCTTCATGTCACCCATAACATCGTCCGGGAGCTTAACCC TTTCGAGAGTTAGGATTAGGGCATGTTTCTTTGGTGGGATAATCACGTTGCCGGCCTCTTCAACATCGATTAGTTTCCCC TCTACGTATGCCTCCTTTCCGACCCTCAGGTCGTAGCCTGCAGGTTGAAGTGATTCCTTCGAGAAGGGTTCGATGAGTAT CTCCTTTTCGATCTTCCAGTCTGGGAGCATCATGGCTTT