tg0490

Coordinates:475127-475597

>tg0490 Deoxycytidine triphosphate deaminase (dCTP deaminase) (dcd)
MMLPDWKIEKEILIEPFSKESLQPAGYDLRVGKEAYVEGKLIDVEEAGNVIIPPKKHALILTLERVKLPDDVMGDMKIRS
SLAREGILGSFAWVDPGWDGNLTLMLFNASNEPVVLEYGERFVQIAFIRLEEPAKRPYRGNYQGSRRIALSKRRVRK

>tg0490 Deoxycytidine triphosphate deaminase (dCTP deaminase) (dcd)
atgatgctcccagactggaagatcgaaaaggagatactcatcgaacccttctcgaaggaatcacttcaacctgcaggcta
cgacctgagggtcggaaaggaggcatacgtagaggggaaactaatcgatgttgaagaggccggcaacgtgattatcccac
caaagaaacatgccctaatcctaactctcgaaagggttaagctcccggacgatgttatgggtgacatgaagataaggagc
agtttggcaagagaggggatactcggctcgttcgcgtgggtcgaccctggatgggacggcaatcttacgctcatgctttt
caacgcatcgaacgaaccagtcgttctggaatacggggaaaggttcgttcagatagcgtttataaggcttgaagaacctg
caaaaaggccctaccgcggaaactatcaggggagcaggagaatagcgctctcaaagagaagggtcagaaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 474627 - 476097 (Additional range around tg0490 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCGCCAGCACTGAAGCTTTTGGAAAAAGCTTCACCAAAGAAACTTTGCTGGGCAAAGTTTCATTAAAGTTGTGATTCTT TTAGCAGCGTCACTTTGAGAGTGTTTGCGCTTTTAATGGACTCGTGTAAAATGCGAATTCTTAGATTTTAGAAGCTTTCT CACGTGGGTTTACTTTTTCCCGCGCTCCAAAGGAGCGCTTCTTAGAGAAACCTCTCCCAGAGGGTTCCTCGAAAAGAATT CTTTGAGAGTACTATCATTTGAAAGCGCAAACTCCTTAGAATTACCTTTTAGACAAGAATCACAAACCTTGATGAAACCT CGTGCAGATAAATTTTGGGGGTGTTGGGGCGGAGCCCCCCTTGTCTTTCGTATGGCGGGCCGGGCGGGATTTGAACCCGC GACCTTCGGCTCCGAAGGCCGACGCCCCATCCAGGCTAGGCCACCGGCCCTTCGGAACCGTTTTAAGGCGACCCAAAATA AAGCTTGCGGTGGAAAGCC atgatgctcccagactggaagatcgaaaaggagatactcatcgaacccttctcgaaggaa tcacttcaacctgcaggctacgacctgagggtcggaaaggaggcatacgtagaggggaaactaatcgatgttgaagaggc cggcaacgtgattatcccaccaaagaaacatgccctaatcctaactctcgaaagggttaagctcccggacgatgttatgg gtgacatgaagataaggagcagtttggcaagagaggggatactcggctcgttcgcgtgggtcgaccctggatgggacggc aatcttacgctcatgcttttcaacgcatcgaacgaaccagtcgttctggaatacggggaaaggttcgttcagatagcgtt tataaggcttgaagaacctgcaaaaaggccctaccgcggaaactatcaggggagcaggagaatagcgctctcaaagagaa gggtcagaaag TAAAGAAAATGGGAGGAGTTCAGCCGAAGAGGGCACCGAGACCAGCGAGGGCCTCCTCCTCGCTGACC TCCTCTTCTTCCTCCTCTTCTTCCTCCTGGGCCTCCTCGGCACCGCCCTCTGCAGGGGCAGGAGCGGCGGCGACCGCGAC CGGAGCGGCGACCGGCATGGCGGCCTTCTCAATGACCTCGTCGATGTTGACACCCTCAAGGGCGGCAACGAGGGCTTTTA TCCTGGCCTCATCTGGGCTAACACCGGCGGCCTCAAGCACCTTCTTGAGGTTCTCCTCGTTTATCTCCTTACCAGCGGCG TGGAGCAGCAGAGCGGCATACACATACTCCATCTTTTCACACCTCCAATCATCTTCATTTTTTCATCCATTTCACATGGA TCCACAGGATACGAGGGAAATTGAAAGTTTCAGCCGAAGAGGGCGCCCAGTCCAGCGAGGGCCTCCTCCTCGCTTGCTTC CTCCTCTTCTTCCTCTTCCTCCTCGGCCTCCT