tg0499

Coordinates:482594-483151

>tg0499 DNA-directed RNA polymerase subunit E′ (rpoE1)
MYKLLKVKDVVRIPPRMFTMDPKEAAKLVLRGTYEGIYDRDEGVVLAVLDVEEVSEGVIVPGDGATYHEVVFNVLVWQPF
MHEVVEGEVIDVAPYGAFVRIGPMDGLVHISQLMDDYVVFDEKNKQFLGKETKRILKLGDEVRARVIAISVKSRVIRENK
IGLTMRQPGLGKFEWIEKEKRKSKEA

>tg0499 DNA-directed RNA polymerase subunit E′ (rpoE1)
atgtacaagttgctgaaggttaaggacgtcgtcaggatcccgcccaggatgttcacaatggatccaaaggaagcggcaaa
actcgtcctccgcgggacatatgagggcatctacgacagggacgagggcgttgtattagccgttcttgacgtcgaggaag
tgagcgagggagtcattgttccgggggacggggcgacgtaccacgaagtcgtcttcaacgttctcgtgtggcaaccgttc
atgcacgaggtcgtcgagggagaggtaattgacgtggccccgtacggagcctttgtcaggatcggaccaatggacggcct
cgtccacatcagtcagcttatggacgactacgtcgtgttcgatgaaaagaacaagcagttcctcggcaaggaaaccaaga
ggatcctcaagctcggtgacgaggtcagggcaagggtgatagcgataagcgttaagagccgcgttatcagggaaaacaag
ataggcctcacaatgcgtcagcctggcctcggaaagttcgagtggattgagaaggagaagaggaaatccaaggaggca


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 482094 - 483651 (Additional range around tg0499 is :500nt.)

>Thermococcus gammatolerans EJ3 ATTCCGAAGGGTAGCAGGAACAAGTACGAGCTCGACAAGAAGACCGGCCTGCTTAAGCTTGACCGCGTCCTTTACAGCCC GTTCTTCTACCCGGTGGACTACGGAATAATTCCCCAGACTTGGTACGACGACGGAGACCCGTTCGACATAATGGTCATAA TGCGCGAGCCAGTTTACCCGCTCACCATCATCGAGGCTAGGCCGATAGGCATTATGAAGATGGAGGACTCTGGAGATAAA GACTGGAAGGTCTTAGCCGTTCCGGTCGAGGATCCGTACTTCAAGGACTGGAAGGATATCGACGACGTTCCCAAGGCCTT CCTCGACGAGATTGCCCACTTCTTCCAGCGCTACAAGGAGCTCCAGGGGAAGACAACCGTTGTTGAGGGCTGGGGCAACG CCGAGGAGGCCAAGAGGGAAATCCTCCGTGCCATAGAGCTCTACAAGGAGAAGTTCGGAAAGGAGTGAGTTCTCCTTCCA ACTTTTTTGGAGGTTCGGCC atgtacaagttgctgaaggttaaggacgtcgtcaggatcccgcccaggatgttcacaat ggatccaaaggaagcggcaaaactcgtcctccgcgggacatatgagggcatctacgacagggacgagggcgttgtattag ccgttcttgacgtcgaggaagtgagcgagggagtcattgttccgggggacggggcgacgtaccacgaagtcgtcttcaac gttctcgtgtggcaaccgttcatgcacgaggtcgtcgagggagaggtaattgacgtggccccgtacggagcctttgtcag gatcggaccaatggacggcctcgtccacatcagtcagcttatggacgactacgtcgtgttcgatgaaaagaacaagcagt tcctcggcaaggaaaccaagaggatcctcaagctcggtgacgaggtcagggcaagggtgatagcgataagcgttaagagc cgcgttatcagggaaaacaagataggcctcacaatgcgtcagcctggcctcggaaagttcgagtggattgagaaggagaa gaggaaatccaaggaggca TGAGCATGGTCAAGGAGAGGGCCTGCAGGCACTGCCATTACATAACGACCGAGGACCGCT GTCCCGTCTGTGGAAGCCGGGATCTCAGCGATGAGTGGTTTGACCTCGTCATAATCATAGACCCAGAGAAGAGCAGGATC GCCAAAAAGCTCGGTGTAAAAGTGCCCGGAAAATACGCCATTCGCGTGAGATGACATGTGCGGTGACTTCTACTTTTATC TACCCCCCAGCTTACGGGATAAACTCAAGGAGCCTTTGGGAGAACTGGTTAGGGGTGAGATTCCGGAACCCTACCTCAGA ATTCTTCCTCTCCTTAGGAAGGTGCCTTTTCTGATCACCGTTGGCGATGTTGTGACTGAAAACGTAATCAGGTTAGGGAT GCACCCGTCGGTGGCGATATACGATCACAGAACAAAGAGAAGGGACTACAACCCCTCAGTTGGCTCGGAGGCGGTCTTTT TAACCGTTAGAAATCCCCCGGGCACGATAACGAAAGCTT