tg0501

Coordinates:483347-483886

>tg0501 hypothetical protein TGAM_0501
MCGDFYFYLPPSLRDKLKEPLGELVRGEIPEPYLRILPLLRKVPFLITVGDVVTENVIRLGMHPSVAIYDHRTKRRDYNP
SVGSEAVFLTVRNPPGTITKALLNAVRKGVEIAGRGRSVHIKVNGEEDLAAIPAVLYAPLGSVVLYGQPDEGVVLIKVTP
ECKRRCASILAKMEVVRDGD

>tg0501 hypothetical protein TGAM_0501
atgtgcggtgacttctacttttatctaccccccagcttacgggataaactcaaggagcctttgggagaactggttagggg
tgagattccggaaccctacctcagaattcttcctctccttaggaaggtgccttttctgatcaccgttggcgatgttgtga
ctgaaaacgtaatcaggttagggatgcacccgtcggtggcgatatacgatcacagaacaaagagaagggactacaacccc
tcagttggctcggaggcggtctttttaaccgttagaaatcccccgggcacgataacgaaagctttattaaacgccgtcag
aaagggagtcgagatcgccggcaggggaaggagtgttcatattaaggttaacggtgaggaagacctcgcggcgatccctg
ccgtgctatacgctcccctcggctcggtcgtcctctatggccagcccgacgagggggtagtgcttataaaggtaacaccc
gaatgcaagcgcaggtgtgcgagtatcttagccaagatggaggtggttcgtgatggagat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 482847 - 484386 (Additional range around tg0501 is :500nt.)

>Thermococcus gammatolerans EJ3 TCGAGGGAGAGGTAATTGACGTGGCCCCGTACGGAGCCTTTGTCAGGATCGGACCAATGGACGGCCTCGTCCACATCAGT CAGCTTATGGACGACTACGTCGTGTTCGATGAAAAGAACAAGCAGTTCCTCGGCAAGGAAACCAAGAGGATCCTCAAGCT CGGTGACGAGGTCAGGGCAAGGGTGATAGCGATAAGCGTTAAGAGCCGCGTTATCAGGGAAAACAAGATAGGCCTCACAA TGCGTCAGCCTGGCCTCGGAAAGTTCGAGTGGATTGAGAAGGAGAAGAGGAAATCCAAGGAGGCATGAGCATGGTCAAGG AGAGGGCCTGCAGGCACTGCCATTACATAACGACCGAGGACCGCTGTCCCGTCTGTGGAAGCCGGGATCTCAGCGATGAG TGGTTTGACCTCGTCATAATCATAGACCCAGAGAAGAGCAGGATCGCCAAAAAGCTCGGTGTAAAAGTGCCCGGAAAATA CGCCATTCGCGTGAGATGAC atgtgcggtgacttctacttttatctaccccccagcttacgggataaactcaaggagcc tttgggagaactggttaggggtgagattccggaaccctacctcagaattcttcctctccttaggaaggtgccttttctga tcaccgttggcgatgttgtgactgaaaacgtaatcaggttagggatgcacccgtcggtggcgatatacgatcacagaaca aagagaagggactacaacccctcagttggctcggaggcggtctttttaaccgttagaaatcccccgggcacgataacgaa agctttattaaacgccgtcagaaagggagtcgagatcgccggcaggggaaggagtgttcatattaaggttaacggtgagg aagacctcgcggcgatccctgccgtgctatacgctcccctcggctcggtcgtcctctatggccagcccgacgagggggta gtgcttataaaggtaacacccgaatgcaagcgcaggtgtgcgagtatcttagccaagatggaggtggttcgtgatggaga t TAAGGTGACCGAGATAAGGGAAAACAAGCTCCTGGGAAGAAAGGAGATATACTTCGACATTATCCACGAGGGCGAGCC TACCCCGAGCAGGGAAGCGGTGAAGGGCAAGCTCGCCGCAATGCTCGACCTAGACCCAAACACTATGGTCCTCCAGTACA TAAGGAGCTACTTCGGAAGCCACGTTTCCAAGGGCTACGCCAAGGCCTACGAGACGAGGGAGAGGATGCTCTACATTGAG CCCGAGTACATCCTCCTCCGCGATGGCCTCATCCAGAAGGAGGAAGAGTGAGGTGGTGTGAATGGCCAAGAAGAAAAAGA CCAGCCAAAAGTGGAAGCTCTACGAGGTTAAGGGAGGAAAGGTCGTCAGGAAGAACAAGTTCTGCCCGCGCTGCGGCCCC GGTGTCTTTATGGCCAACCACAAGGATCGCTGGTCCTGCGGAAGGTGCGGCTACACCGAGTGGAAGAAGTGATTCTCCTT TTCTTTCTCCCCGGCGGTGAC