tg0503

Coordinates:484186-484353

>tg0503 SSU ribosomal protein S27AE (rps27AE)
MAKKKKTSQKWKLYEVKGGKVVRKNKFCPRCGPGVFMANHKDRWSCGRCGYTEWKK

>tg0503 SSU ribosomal protein S27AE (rps27AE)
atggccaagaagaaaaagaccagccaaaagtggaagctctacgaggttaagggaggaaaggtcgtcaggaagaacaagtt
ctgcccgcgctgcggccccggtgtctttatggccaaccacaaggatcgctggtcctgcggaaggtgcggctacaccgagt
ggaagaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 483686 - 484853 (Additional range around tg0503 is :500nt.)

>Thermococcus gammatolerans EJ3 GGCAGGGGAAGGAGTGTTCATATTAAGGTTAACGGTGAGGAAGACCTCGCGGCGATCCCTGCCGTGCTATACGCTCCCCT CGGCTCGGTCGTCCTCTATGGCCAGCCCGACGAGGGGGTAGTGCTTATAAAGGTAACACCCGAATGCAAGCGCAGGTGTG CGAGTATCTTAGCCAAGATGGAGGTGGTTCGTGATGGAGATTAAGGTGACCGAGATAAGGGAAAACAAGCTCCTGGGAAG AAAGGAGATATACTTCGACATTATCCACGAGGGCGAGCCTACCCCGAGCAGGGAAGCGGTGAAGGGCAAGCTCGCCGCAA TGCTCGACCTAGACCCAAACACTATGGTCCTCCAGTACATAAGGAGCTACTTCGGAAGCCACGTTTCCAAGGGCTACGCC AAGGCCTACGAGACGAGGGAGAGGATGCTCTACATTGAGCCCGAGTACATCCTCCTCCGCGATGGCCTCATCCAGAAGGA GGAAGAGTGAGGTGGTGTGA atggccaagaagaaaaagaccagccaaaagtggaagctctacgaggttaagggaggaaa ggtcgtcaggaagaacaagttctgcccgcgctgcggccccggtgtctttatggccaaccacaaggatcgctggtcctgcg gaaggtgcggctacaccgagtggaagaag TGATTCTCCTTTTCTTTCTCCCCGGCGGTGACGATGCCCATTTATTATGG AATCAAGCTGGAGCTCCATTCGGACGTCTATGAGCCGGCGGAAGACACTTTCCTCCTCGCCGAGACCCTCGAGGTCAGAC CGGGGGAGATTGCCCTCGACGTTGGAACCGGAACGGGACTGATAGCTCTCCTGATGGCGAGAAAAGCAAAGTACGTCTTG GGCGTTGACGTGAATCCCAAGGCAGTCGAACTCGCTCGAAGGAACGCTCGACTGAACGGTATAAGCAACGTCGAGTTTCG CCTGAGCGACTTATTTGAGAACGTCTCGGGCAGGTTCGATGTGATAACTTTCAACGCCCCCTATCTTCCAGGCGAGCCCG AGAAAGCTATAGATCTGGCCCTCGTTGGGGGTAAAACCGGGAGGGAGGTAATAGACCGCTTTATAGCTGAAGTGCCTGAC CACCTGAACGAGAACGGCCGGGTTTACCTCGTACAGAGCTCGATAACAG