tg0505

Coordinates:484973-485638

>tg0505 hypothetical protein TGAM_0505
MLEGYYIVENTGVVPAERRFKFKDLKAWGYDLHLGTIDGKEAYFVSRTGTHEEGETYTQDGREYHITETQREIPKNARLL
ARIVIERGQPYLEFWLEAEEANYPLAKEDPRLILHRFWTAKKFNQLEKHVGSVGLTTDFFKDRVFVKSLPLPFEEYPPKV
RRVLREVRDVHRDLTGFGRFVFQYYGEEDKTHNYRLWWLLPTIHLFDIEVSNEVDKILAMLD

>tg0505 hypothetical protein TGAM_0505
atgctcgagggctactacatagtcgaaaacaccggagtcgttccggccgagaggaggttcaagtttaaggatctgaaggc
gtggggttatgacctgcacctaggaacgatagacggtaaggaggcctacttcgtctcaagaacgggaactcacgaggaag
gagaaacctacacgcaggacggaagggagtaccacatcaccgagacgcagagggagataccgaagaacgcaagacttttg
gcgaggatcgtaatcgagcgcggccagccctacctcgagttctggcttgaggctgaggaagcaaactacccgctcgccaa
ggaggacccgaggctaatccttcaccgcttctggacggccaagaagttcaaccagctcgaaaagcacgtcggaagcgtgg
gcctaacaactgacttcttcaaggacagggtcttcgtgaagagccttccgcttcccttcgaggagtacccgccaaaggtt
aggagggttctgagagaagtcagggacgtgcacagggatttgacgggcttcggaaggttcgtcttccagtactacggaga
ggaagacaagacccacaactaccgcctttggtggctcctgccgacgatacacctcttcgacatcgaggtctcaaacgagg
tggacaagattttggcgatgctcgat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 484473 - 486138 (Additional range around tg0505 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTCTTGAACATCCCGCAGAGGGGGGTTAACTTGGGGAGCTCCTCAGGGGTAACACTAAAGCCGCCAATGAGGGGACCCC GTTCACCATACTCCTCCCTCTCTTTGGAGCCACTGAGAACCCGAGAGGAAAGGCGGAGGTAATGGATGACAGACACCATC AGGAGGACGTAAGAAACAAGGAAAAGGGCCGCTTCGAGCCACCAGAGAACCTTTCCTGTCACGGCGTCGATTATAACGAC AATGCTAGCGGCTACTGCGAGGAGTCCTGAAAGAATAACGTTCATGGAGAACTTCCTTGAGAGGGGCGCCACGATACTTC GGGAGTAAAGGTAAGCCAAGATAAGTAGGACAGAGTACACCATCAGGGAAACCAGACCAGCGATCAGCACCGCCACCTTA ACCACGAAAGCACCTCACTATCCTTGTACACCTATCCCTTAAGACATTTTGGGGAAAAGCTTAAATAGGGTCAGTTTTTA ATAACAAAAGGTGATCAAA atgctcgagggctactacatagtcgaaaacaccggagtcgttccggccgagaggaggttc aagtttaaggatctgaaggcgtggggttatgacctgcacctaggaacgatagacggtaaggaggcctacttcgtctcaag aacgggaactcacgaggaaggagaaacctacacgcaggacggaagggagtaccacatcaccgagacgcagagggagatac cgaagaacgcaagacttttggcgaggatcgtaatcgagcgcggccagccctacctcgagttctggcttgaggctgaggaa gcaaactacccgctcgccaaggaggacccgaggctaatccttcaccgcttctggacggccaagaagttcaaccagctcga aaagcacgtcggaagcgtgggcctaacaactgacttcttcaaggacagggtcttcgtgaagagccttccgcttcccttcg aggagtacccgccaaaggttaggagggttctgagagaagtcagggacgtgcacagggatttgacgggcttcggaaggttc gtcttccagtactacggagaggaagacaagacccacaactaccgcctttggtggctcctgccgacgatacacctcttcga catcgaggtctcaaacgaggtggacaagattttggcgatgctcgat TGAGCTATCCTTTCTTTTCTGCGAGGATAACGA CGATGTCCTCAAAGAAGAGGTGCCTCCTGGCTATAACCTCACCCCTAAGGCCGGCTTTCTCAAACTCCCTCATTGTCTCT TCAACCCCTGTTATCGAGCTCTGTACGAGGTAAACCCGGCCGTTCTCGTTCAGGTGGTCAGGCACTTCAGCTATAAAGCG GTCTATTACCTCCCTCCCGGTTTTACCCCCAACGAGGGCCAGATCTATAGCTTTCTCGGGCTCGCCTGGAAGATAGGGGG CGTTGAAAGTTATCACATCGAACCTGCCCGAGACGTTCTCAAATAAGTCGCTCAGGCGAAACTCGACGTTGCTTATACCG TTCAGTCGAGCGTTCCTTCGAGCGAGTTCGACTGCCTTGGGATTCACGTCAACGCCCAAGACGTACTTTGCTTTTCTCGC CATCAGGAGAGCTATCAGTCCCGTTCCGGTTCCAACGTCGAGGGCAATCTCCCCCGGTCTGACCTCG