tg0520

Coordinates:497200-497874

>tg0520 hypothetical protein TGAM_0520
MGALTFTAKDEPGIGFRIGYTYLSERARRRANRVSGAGIMLTGVLLILLSFFLPMPWLMAVLLSCFGVIIPVTYLVAKRE
YELEELSEEAPEKPERKIRPPRVGKYLALQTVFVGLSLVLLINGKLPDREISILIFVQLFLLALTVPFSQPLVFQLAPKF
KGKMALGFAKAMTVVSAMVALQLAVAALKPKASPLLVVLMLLVSLGAIFYAVFVALTSAYEEGYY

>tg0520 hypothetical protein TGAM_0520
ATGGGGGCTCTCACATTCACAGCGAAGGACGAACCCGGGATAGGCTTTAGGATAGGATACACCTATCTCTCGGAGAGGGC
GAGGAGGAGGGCCAACCGCGTTTCGGGGGCCGGAATTATGCTGACCGGGGTCCTCCTGATCCTCCTCTCCTTCTTCCTGC
CAATGCCTTGGCTGATGGCGGTTCTTCTCTCCTGCTTTGGAGTGATTATTCCGGTGACTTATTTGGTTGCAAAGCGCGAG
TACGAGCTTGAGGAGCTATCCGAGGAGGCCCCCGAGAAGCCCGAAAGGAAAATAAGGCCGCCGCGGGTTGGGAAGTATTT
GGCGCTCCAGACGGTCTTTGTAGGGCTCTCCCTGGTCCTCCTAATCAATGGGAAGCTTCCAGACCGGGAAATTTCCATAC
TCATCTTTGTCCAGCTCTTCCTCCTCGCGCTTACTGTTCCCTTCTCTCAGCCCCTCGTCTTCCAGCTGGCGCCAAAGTTC
AAGGGGAAGATGGCGCTCGGCTTCGCGAAGGCGATGACGGTGGTATCTGCGATGGTAGCGCTTCAGCTGGCAGTTGCTGC
ATTAAAGCCCAAGGCGAGCCCGCTCCTCGTAGTCCTCATGCTCCTCGTCTCCCTAGGCGCGATATTCTATGCGGTTTTCG
TAGCTTTAACGAGCGCTTATGAGGAGGGTTACTAT


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 496700 - 498374 (Additional range around tg0520 is :500nt.)

>Thermococcus gammatolerans EJ3 CAGAGCATCAGCATAAAACCCTACATCCTCATTCAGCTCGGCTTTTTAGCCATCTACCTCCTGCTGGTTGCCCTCCTGTG GGAGAGGCTCCCCGAGAGGGTTGCGACCCACTTCAACGCGAGCGGTGAGCCGGACAGCTATTCGAGCAAGTTCTGGGGAG TTATCGGCGTTCCGGTTCTGGTCTGGCTTCTTCCGTTAGTTCTCACGATTCCGGCCAGGGAACCGGGATTCTTCGCGAGG GTCGCCTTCTACCCGAGGAGCCTGAGGGCGTGGTGCCTCTTCACAACGGTTCTGAGCGGTGGAATTGTTCTCGTCGTTAC TCTCGCCCTCCTCTACAACGCGGGCCTCGTCTCGGGCAACGCAATAACCTACGGGGCCTACCTTTTCCTCGGCGTGCTCA TCTTTGCAGTCTACAGGCTCCTCACGGTGGGGAAAGGTGAACGGGTATGAGCTCCTGAGGATTCTCTACGGGCTGTTCCT CGGGGTTTTCCTCATAGTC ATGGGGGCTCTCACATTCACAGCGAAGGACGAACCCGGGATAGGCTTTAGGATAGGATAC ACCTATCTCTCGGAGAGGGCGAGGAGGAGGGCCAACCGCGTTTCGGGGGCCGGAATTATGCTGACCGGGGTCCTCCTGAT CCTCCTCTCCTTCTTCCTGCCAATGCCTTGGCTGATGGCGGTTCTTCTCTCCTGCTTTGGAGTGATTATTCCGGTGACTT ATTTGGTTGCAAAGCGCGAGTACGAGCTTGAGGAGCTATCCGAGGAGGCCCCCGAGAAGCCCGAAAGGAAAATAAGGCCG CCGCGGGTTGGGAAGTATTTGGCGCTCCAGACGGTCTTTGTAGGGCTCTCCCTGGTCCTCCTAATCAATGGGAAGCTTCC AGACCGGGAAATTTCCATACTCATCTTTGTCCAGCTCTTCCTCCTCGCGCTTACTGTTCCCTTCTCTCAGCCCCTCGTCT TCCAGCTGGCGCCAAAGTTCAAGGGGAAGATGGCGCTCGGCTTCGCGAAGGCGATGACGGTGGTATCTGCGATGGTAGCG CTTCAGCTGGCAGTTGCTGCATTAAAGCCCAAGGCGAGCCCGCTCCTCGTAGTCCTCATGCTCCTCGTCTCCCTAGGCGC GATATTCTATGCGGTTTTCGTAGCTTTAACGAGCGCTTATGAGGAGGGTTACTAT TAGCTCTCGAGGGCATTGATTAAC TTTTCCCGATCGGGCTCATCAATGATTCCCAGCTCGACGGCGTGCCTCAGGACGCAGTCTGGAAAATCTCCCTCGAAAAA CGCTCTCAGGCCCTTTCCTGGGATGTAGAAGGCGTAAACCCTGACGCTCCTGCCGAGGCACCTCCCCCTCGCTACCATGA AGCCCTTCTCCGCGTTAATTCTGGCAACTTCCCACGAGAAAACCTCAGCCAATCCAAAGAAGGCCTCGAAGAGCTTGACC CTCGCGTCCCTCAGGGCCTTGTTGACGGCCTGCCTTGAAACTCCGAGCTCCCTCGCTATCTCGATCTCGCGCATGCCCTT GGCCCTCATGAGCCAGACGCGCTCCATGGCCTCAGGAAGCCGGAACATTCGAACCACCGCTACCGCTTATGAGTCTCCTC AAGTTATCAATAAACTGCTCAATTTCCCTGTCTGAGAGAGACGACACGAGGTACGTTCCCTTTTCGGTTACAAGAA