tg0523

Coordinates:499099-499827

>tg0523 hypothetical protein TGAM_0523
MSPFLFIILGGFLAWATVYAVGFRKLRWAEFILGLVAFLLAMIIQNPVQQLPLMGMGITSNKDVVARGTGFMVIVAVWLG
LAAGIIQEGIKYYLVRERKLREAVFVGLGFGVTEAVVIAVAKVLPVVLKGGSVEVPLLSALLSMAERYFATLFHVGTAVF
LAYSAKQGFGKRGLIYMIGLHTIIDSGAAYFQLAFFMKPRPYHTLNFLAYFLEVVAAVIGIVVFAYGVLKALEEPEDEEK
PIW

>tg0523 hypothetical protein TGAM_0523
atgtccccgtttttatttataattctcggcgggttcttggcctgggcgacagtttacgctgtgggcttcaggaagttgag
gtgggccgagttcattctgggccttgtggcgtttttactcgcgatgataatccaaaatcccgttcagcagcttcccctaa
tgggaatgggcataacatcaaataaggacgtcgtcgcgaggggaactgggtttatggtgattgttgcagtctggcttgga
ctggctgcgggcatcatccaagaggggatcaagtactacctggtcagagagaggaagcttcgcgaggcggtcttcgttgg
tcttggctttggtgtcacagaggcagttgtgatagcagtggccaaggttctcccggttgtcctgaagggtggctccgtcg
aggtgcccctgttgagtgccctcctatcaatggccgagcgttacttcgcaacgcttttccacgtgggaacggctgttttc
cttgcctattcggcaaagcagggttttggaaagaggggtctcatatacatgattggtctgcatacaataatagacagtgg
cgcggcctacttccagctggccttcttcatgaagcccagaccgtaccatacgttaaacttcctggcctatttccttgagg
ttgtggcagccgtcattggaattgtggtgtttgcatacggagtgctaaaggcacttgaggagccggaagacgaagaaaag
cccatatgg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 498599 - 500327 (Additional range around tg0523 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCCACAGGAGGTCTACGACGATCCCATGACATACACCATCTACTACCACAAGGCTTGATTCTCTGCCCTTCCTTTTTGT TTCCCAAATCAAAAGCCTTTTATACATCCTCATCCAACAATACCTCGAAGTTCGATGCATCGGGGTGAGATGTATGGAGA CAATTGAGGGGGTTGTTGTCGTAACGACCGAGACGGTTCCGGGGTACCGGATCGTTGAGGTCAAGGGCCTCGCGAGGGGC GGTGTCGTCAAGGCCACCCACATCGGTAGGGACATACTCGCCGCCCTCAGGAACATCAAGGGCGGTGAAGTCAAGGAGTA CACTCAGATGATGGCCGAGGCACGGGAAGAGGCCTTAAGGAGGATGGCGCTCAGCGCCAAAGAGCTCGGCGCAAACGCCG TTGTTAACATGCGCTTTGCCACCTCAAACGTCAGCTCAAACATGGCCGAAGTTTACGCCTACGGGACTGCGGTGGTCATC GAGAAGGAGGAGTGAAGCT atgtccccgtttttatttataattctcggcgggttcttggcctgggcgacagtttacgct gtgggcttcaggaagttgaggtgggccgagttcattctgggccttgtggcgtttttactcgcgatgataatccaaaatcc cgttcagcagcttcccctaatgggaatgggcataacatcaaataaggacgtcgtcgcgaggggaactgggtttatggtga ttgttgcagtctggcttggactggctgcgggcatcatccaagaggggatcaagtactacctggtcagagagaggaagctt cgcgaggcggtcttcgttggtcttggctttggtgtcacagaggcagttgtgatagcagtggccaaggttctcccggttgt cctgaagggtggctccgtcgaggtgcccctgttgagtgccctcctatcaatggccgagcgttacttcgcaacgcttttcc acgtgggaacggctgttttccttgcctattcggcaaagcagggttttggaaagaggggtctcatatacatgattggtctg catacaataatagacagtggcgcggcctacttccagctggccttcttcatgaagcccagaccgtaccatacgttaaactt cctggcctatttccttgaggttgtggcagccgtcattggaattgtggtgtttgcatacggagtgctaaaggcacttgagg agccggaagacgaagaaaagcccatatgg TGATAGAGCTTGCTTGGAAACCCTAAAGAAAAGGCCCTCAGAAAGCTCAG GAAGGACCTGCGCTCCGGACTTTACTCCTACCTAGTCCTCTCCCTCCTCAGCGAGGAGGGCGAGCTTCACGGCTACGCGA TAAGGAAAAGGCTCGGAGAGCTTAGCGACGGCAAACTCGTCCCGAGCGAAGGAGCCCTCTACGACATCCTGAAGAACCTG AAGAAGCTCGGCCTTTTGCGAGACGACTGGGCTGAAGTTGGCGGGAGGCCGAGGAAGTACTACCGCCTCACCGATCTCGG TAGGGACGTTTTGTTGGCGCTGAGGGATGAAATCAGGACGATTGAAAGAACCCTCATAAGGCTGGAGGGATTGGAATGAA CGAGAAGGCCTTCGAGGTGTTTGTTTCCCTCACCCTGCTTTTGGCTGGACTGCTGACCCTCGCCTTCAGAAAGAAGCAAA ACCCTCTAATCGGCTTTCGCGTGGGTTACACCTATCACTCCGAACGGGCC