tg0531

Coordinates:505929-506546

>tg0531 SAM-dependent rRNA adenine methyltransferase, putative
MKKRHLAMLLSKLEGFSEPKPELEQYRTPGNVAAELLWLAHSAGDIVEKVVADLGTGTGVLAIGAKLLGAEKVYAVEVDP
KALEVAKRNAERSGVEVEFIQADVSEFSERVDTVVMNPPFGSQKKGADRPFLLKAFEVSNTVYSIHLAKLEVRSFIERFS
ADNGFTAFRLATVPFEIPAQFFFHRKKLERILVDLYLFRRVPDGKA

>tg0531 SAM-dependent rRNA adenine methyltransferase, putative
atgaaaaagaggcacctcgcgatgctcctgtcgaagcttgagggtttctccgagccgaaaccggagctggaacagtaccg
gacaccgggaaatgtagcggcggaactgctgtggttagctcactccgccggtgacatagtggagaaagtcgttgccgacc
ttggaaccggaactggggttctggcgattggagcgaagctcctcggggcggagaaggtttacgcagtcgaagttgacccg
aaggcccttgaagtggccaagagaaacgccgagcggtctggtgttgaagtcgagttcattcaagcggacgtctctgagtt
cagcgagcgggttgacaccgttgtgatgaaccctcccttcgggagccagaagaagggcgcggacaggcccttcctgctta
aggcttttgaagtttctaatacggtttactcaatccatctcgcgaagctggaggtaaggagttttatcgagaggttctcg
gcagataacgggttcactgcatttcggctggcgaccgtcccttttgagattccggcccagttcttcttccacagaaagaa
gctggagcggattttagtggatctgtaccttttcaggagggttccggatgggaaagct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 505429 - 507046 (Additional range around tg0531 is :500nt.)

>Thermococcus gammatolerans EJ3 CAAGAACAGTTATGGAGTCAAAGACAATGATATCCGGCTTCCATTCCACGAGATCTTGAATAAGAAAGTCAAGAAAGTCC TTCATTTCTTCCTTGGGCATTGTAAGCATGTCATAAAACTTGAAAACACCTTTTTTCTCAGCCTCTTCGAAGTTTAACCC GCTTTCCATAGCGTTCTGATAAAACTGCCTTTTTGTTTCAGCAAAGGAAATATAAGCGCCTTTCAGTCCTTTTTTCATGT TATTAAAAAGAACATGAACAGCTAGGTGAGTTTTTCCAGTTCCAGGATTTCCAGCTATTAGAATGCTAGTACCCCTTGAG AACCCACCTGATAGGGCTTTATCAAGCCCAGGTATCCCCGTAGGTATGAGTTCCATACCTTGTCACCTTGTTTTTTACAC AACATCAAAGATATAAATACATTTCGTTAGAATTTTCAAGGTTCCACAAGACTTAATATTTCCTCAACATAATATCAAAC TGGTATCCACGGTGAGCAAC atgaaaaagaggcacctcgcgatgctcctgtcgaagcttgagggtttctccgagccgaa accggagctggaacagtaccggacaccgggaaatgtagcggcggaactgctgtggttagctcactccgccggtgacatag tggagaaagtcgttgccgaccttggaaccggaactggggttctggcgattggagcgaagctcctcggggcggagaaggtt tacgcagtcgaagttgacccgaaggcccttgaagtggccaagagaaacgccgagcggtctggtgttgaagtcgagttcat tcaagcggacgtctctgagttcagcgagcgggttgacaccgttgtgatgaaccctcccttcgggagccagaagaagggcg cggacaggcccttcctgcttaaggcttttgaagtttctaatacggtttactcaatccatctcgcgaagctggaggtaagg agttttatcgagaggttctcggcagataacgggttcactgcatttcggctggcgaccgtcccttttgagattccggccca gttcttcttccacagaaagaagctggagcggattttagtggatctgtaccttttcaggagggttccggatgggaaagct TAAGCTGAGCGACAGGCAACTCTACGCTCTCATCGAGGCGGTTAAGCTCAGCGAAGCGATAAAACCGAGCCAGCAGGCTA AGAGAAAGGCCTTCTCGCGCTACAAAATCGAGGGCTGGGAGAACTCCAAGCTGACCGGGATCTTCTACTCGATTCAGAGG AGGCTTGGTCTAATAGACGAGGTGATCGAAGAGCTCGTTGGCGTTTCTCCCCTAATCCTCGACCCCTGGCTGAGAGCTAC ACTTAGGGTTGCGGTTGAAGTTGCGGTCTTTAGAGACCCGAACGAGAGGACGCTCCAGCACCTTAAGGGTCTCGCAAAGT TCCTTTCCGGTAGAACGCATCCCTACGTGGGCTATTACTACTACGAACTCCTGCCCAGGGTTATAAACTACGTCCCAAAG CTTAACTCCGAGGAGAAGAGGCTGAAGTGGAAGTATCTCTTTCCCGAGTGGTTCATAGAGAGGATGCACAAACTTTTGGG GGGAGAAGCAGAGGAACTG