tg0538

Coordinates:512928-513626

>tg0538 Cobalamin (5′-phosphate) synthase (cobS)
MRNLLPFFTRIPVKGDFERVRNELWALPLLAPLTSALATLVLYLELPLSNVLAILALYFTTGLLHLDGLADWADGVMVKG
DRERKIKAMKDLNTGIAGVFAVVMVFLLQVYSLPLLPFYALYLAELNSKFAMLLALATRKPLGQGLGAYFMEGMNGRQLT
LGTALYLLLLLPVAYIEPRSISSLLGLLAGAYVIRLSLRNFGGLNGDCIGAVAEITRAGALLGMAVVWVYFGG

>tg0538 Cobalamin (5′-phosphate) synthase (cobS)
gtgcgtaatcttttacccttcttcacgcggattcctgtcaaaggcgacttcgaacgggttaggaatgagctctgggctct
ccccctgctcgcccccctaacttcggccctggcgacgctcgtcctttacctggaactccccctgagcaacgtcttagcca
tcctcgcgctctatttcacgacaggcctcctccacctcgacggcttggctgactgggccgatggagtaatggtcaagggc
gaccgggagagaaagataaaggccatgaaagacctcaacacgggcatagcgggggttttcgccgtcgttatggttttcct
cctgcaggtttactcccttccattacttccgttctacgcgctctacttagccgagctgaactccaagttcgccatgctcc
tcgctctggcaacgagaaagcccctcggccagggccttggggcgtactttatggagggcatgaacggaaggcagttaacc
ctaggaacggccctctacctcctcctgctcctgccggttgcttatatcgaaccccgctctatctcttccctcctcggcct
cttggctggagcatacgttatcagactctcgctaaggaactttggggggctgaacggggactgcatcggggctgtggcag
agataacgagggctggagcgctcctgggaatggcggtggtttgggtttacttcgggggc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 512428 - 514126 (Additional range around tg0538 is :500nt.)

>Thermococcus gammatolerans EJ3 GGGGACTTAAAACTGAAAAACGCCATCAGAGACAGAATCGTCGTCTATTCTCCGTCGGAGCTGTTAAAACTCATGGGTGG TTCTGTATGACACCCAAAGAACTCCTCTCCCGCCTCGAATCCAAAGGCATAACGCTCGAAAAGATGCTCGACACCGCGTT AGAACTCTACATCGGCGACGAGCGCGAGAAAGTCGGGGAAAGGCTGAGGGGGCTGATGCTCCGCTACCTCAGCGACGTAA ACGTCCAAGCTCTACTTCTTTCGGCTCTCCTGCTCGAAGAGAACTTCAAAGTTGAGGGCGACCCCGTGAACCTTGTAGCT GATGAGTTAATTGGGATAAACATCGCCGAGCTCATAGGAGGGAAGATGGCGCTCTTCAACTTCTTCTACTACGACACCAG AAAGCCCGGAATCCTTGCGGAGCTTCCGCCTTTCCTCGATGATGCGATAGGTGGCTTTATAGCGGGCTGTATGACGAGGC TGTTCGAGGAGGTGTAGCG gtgcgtaatcttttacccttcttcacgcggattcctgtcaaaggcgacttcgaacgggtt aggaatgagctctgggctctccccctgctcgcccccctaacttcggccctggcgacgctcgtcctttacctggaactccc cctgagcaacgtcttagccatcctcgcgctctatttcacgacaggcctcctccacctcgacggcttggctgactgggccg atggagtaatggtcaagggcgaccgggagagaaagataaaggccatgaaagacctcaacacgggcatagcgggggttttc gccgtcgttatggttttcctcctgcaggtttactcccttccattacttccgttctacgcgctctacttagccgagctgaa ctccaagttcgccatgctcctcgctctggcaacgagaaagcccctcggccagggccttggggcgtactttatggagggca tgaacggaaggcagttaaccctaggaacggccctctacctcctcctgctcctgccggttgcttatatcgaaccccgctct atctcttccctcctcggcctcttggctggagcatacgttatcagactctcgctaaggaactttggggggctgaacgggga ctgcatcggggctgtggcagagataacgagggctggagcgctcctgggaatggcggtggtttgggtttacttcgggggc TGAATACCTGGAATCACGTCGAGTCTGTCCAGTTCTCTATCTTCGAAAGTCGCGTATGGGATAAACCCCGCTCTCCTGGC CTTGTCTATGAAGTCGAGAATTCTAGCGAGGTTTTCCTCGCTTCCCGTGCCATCATCAACGTAATCAACCACGAAGACGG GCTTTCCAGCGTTGACGACCTTTTTGAGGGGGGGGACCTTTTCGGCCGTCCAAGGACTCGGCTCGAGACCGTTGTAAAAG ACGTCCTCACTCGCCCAGCCTGAAACGGTGGCAAGAAGCGTCCCGTTGTCATATTCGAGCAGGTATTCGCCGTTCTGGGG AATTATTATGAAATCCCGTCCGGCTTTAGAGCGCGTGTAGTTGGCGATTTCGAGAATGAGTTCGATCATCCGCTCCGCCG TCCAGCTCTCATTGTAGCTTTCCGCCCAGAACCAGTACTCGTCGACCTTGTCGAGGTATACGCCCATAAAGCCCTGGGCG ATGATTCTGTCGAGGTAGCG