tg0539

Coordinates:513632-514039

>tg0539 Phosphatidylglycerophosphatase A (PgpA)
MTPKELLSRLESKGITLEKMLDTALELYIGDEREKVGERLRGLMLRYLSDVNVQALLLSALLLEENFKVEGDPVNLVADE
LIGINIAELIGGKMALFNFFYYDTRKPGILAELPPFLDDAIGGFIAGCMTRLFEEV

>tg0539 Phosphatidylglycerophosphatase A (PgpA)
atgacacccaaagaactcctctcccgcctcgaatccaaaggcataacgctcgaaaagatgctcgacaccgcgttagaact
ctacatcggcgacgagcgcgagaaagtcggggaaaggctgagggggctgatgctccgctacctcagcgacgtaaacgtcc
aagctctacttctttcggctctcctgctcgaagagaacttcaaagttgagggcgaccccgtgaaccttgtagctgatgag
ttaattgggataaacatcgccgagctcataggagggaagatggcgctcttcaacttcttctactacgacaccagaaagcc
cggaatccttgcggagcttccgcctttcctcgatgatgcgataggtggctttatagcgggctgtatgacgaggctgttcg
aggaggtg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 513132 - 514539 (Additional range around tg0539 is :500nt.)

>Thermococcus gammatolerans EJ3 ACGAAGAAGAGGCCAAGGCGCTTGAAGACGAGATTGCCGAAGAGATAGCCAGGCGCTACGGAGTGGTCTGAATGGAGGTC GTGCTGGACTACAACGTGGTGTTCTCCGCTCTTTACAATAGAGGCGTTGCCTACAAACTTTTCATGTTGAACCATGTGAC GAAGGACGTTGAATTTTTAGTTCCGGGCTACTTCTGGGAGGAAGTCGAGCGAAAAAAAGACCGCCTCGCCAGATTGACTC GCCTAACATACGAGGACTTCGAATTCATTCTCAGGATTATCAAATCCCAGACGATAACGATGCCAGAGCACGTTGTTAAG ATAGGCATAGAAGAGGCCCTCTCCCTGTCTCCCGACCCAAAAGACATCCCTTACGTTGCTCTTGCGCTCGCCCTTAATCT TCCACTTGTTACGGGGGACTTAAAACTGAAAAACGCCATCAGAGACAGAATCGTCGTCTATTCTCCGTCGGAGCTGTTAA AACTCATGGGTGGTTCTGT atgacacccaaagaactcctctcccgcctcgaatccaaaggcataacgctcgaaaagatg ctcgacaccgcgttagaactctacatcggcgacgagcgcgagaaagtcggggaaaggctgagggggctgatgctccgcta cctcagcgacgtaaacgtccaagctctacttctttcggctctcctgctcgaagagaacttcaaagttgagggcgaccccg tgaaccttgtagctgatgagttaattgggataaacatcgccgagctcataggagggaagatggcgctcttcaacttcttc tactacgacaccagaaagcccggaatccttgcggagcttccgcctttcctcgatgatgcgataggtggctttatagcggg ctgtatgacgaggctgttcgaggaggtg TAGCGGTGCGTAATCTTTTACCCTTCTTCACGCGGATTCCTGTCAAAGGCG ACTTCGAACGGGTTAGGAATGAGCTCTGGGCTCTCCCCCTGCTCGCCCCCCTAACTTCGGCCCTGGCGACGCTCGTCCTT TACCTGGAACTCCCCCTGAGCAACGTCTTAGCCATCCTCGCGCTCTATTTCACGACAGGCCTCCTCCACCTCGACGGCTT GGCTGACTGGGCCGATGGAGTAATGGTCAAGGGCGACCGGGAGAGAAAGATAAAGGCCATGAAAGACCTCAACACGGGCA TAGCGGGGGTTTTCGCCGTCGTTATGGTTTTCCTCCTGCAGGTTTACTCCCTTCCATTACTTCCGTTCTACGCGCTCTAC TTAGCCGAGCTGAACTCCAAGTTCGCCATGCTCCTCGCTCTGGCAACGAGAAAGCCCCTCGGCCAGGGCCTTGGGGCGTA CTTTATGGAGGGCATGAACGGAAGGCAGTTAACCCTAGGAACGGCCCTC