tg0563

Coordinates:528721-528984

>tg0563 Transcription regulator, SpoVT/AbrB family
MVGKVGITKVDSKGRVVIPKDVRRRLNIKPGEEFLVTEIDGDTIVLRRFNVKKMLEKLVRNSREVNLEELEAETEEEGNR
VAKELYRL

>tg0563 Transcription regulator, SpoVT/AbrB family
atggtgggaaaagtgggaataacaaaggtggactccaagggcagggtcgtaatcccaaaggacgttcggaggaggctcaa
catcaagcccggtgaagagttcctcgtcaccgagatagacggcgatacgatagtcctgaggcgcttcaacgtcaagaaga
tgctcgaaaagctcgtcaggaactcaagagaagtaaatttggaggagcttgaggctgaaaccgaggaagaggggaacaga
gttgcgaaggaactctacagacta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 528221 - 529484 (Additional range around tg0563 is :500nt.)

>Thermococcus gammatolerans EJ3 GTGGTTTAAATGGATTGGAGGAAAAGGCTGAAGGGCCTTCTCGAACCGTACGGCGAAATTACTGAAACCGATAAGGGGTT AATCTTTGAGTTCGGCGACGATGAGGGAGACTTCTCCGACAGGCTCGCCTTCATCATTGAGAAACCTGAGGAGTGGCCGC TGGTGGAAGTTGCGGTAAAGGCGATAGCGGATTTAACCGACCACGACGTCCCTGGGAGGAACGTCTTTGCCTTCGGCTTC GAGCCCGACTTTGGGGGAACGCTCCTCAGGCTTCGACTCTTCGAAGGAAAGCCTGGAGAGGGACCGGTAATCGGGGATGT TCCCGAGAAAGTCGTTAAGATAGCGGAGCGCAACGGCATCAAATACCAGCGCGTGGACGGGGAGGGAATCGGCCTTCCGA AGGACTTCACGGAGGAGGACCTTGAGGCCCTGGTAAAGCTCGTGGAGGCCGTTGCCTTTGAATGGTAAGGCTTTAAAACA CCGATGACCAAGAGTAGGA atggtgggaaaagtgggaataacaaaggtggactccaagggcagggtcgtaatcccaaag gacgttcggaggaggctcaacatcaagcccggtgaagagttcctcgtcaccgagatagacggcgatacgatagtcctgag gcgcttcaacgtcaagaagatgctcgaaaagctcgtcaggaactcaagagaagtaaatttggaggagcttgaggctgaaa ccgaggaagaggggaacagagttgcgaaggaactctacagacta TAAATTCCTGCTCGACACAAATGTCTTCATAGCGG CAGTTAAACGGGGTTGGACTGACACGACCGAGCTTTTACTCCATTTTTTAACCAGAAAACGCTACGTTTTGGTGGCAAAC GACGTCTTGATGGCTGAATACCGAAAATACGCCGAAAAGCTCAACGCGCTGGACTTCTATGACGTCATCAGCAGACAGGT CACGATTGTGAATCCCAGCAGAGAAGATGTGCTTCGCGTTCTCCCGTATTTTCCCGAAACCCAACTCGCGGATGCCGTCC ACGCGGCAATGTGTCTGAAAAGCGGGGCAATTCTCGTTACCAATGACAGGCACTTTGAGAAGGTTTCCCGTGCGGGTATT ATTGAAGTATGGAGCATAAGCGACGCCATACGACGCATTTTGAGGGATGGTTAATGCTGAAGTACCTCTCCTACTTCGCG GTCGGGGTCTTCATCGGAATCCTCGCGGCACTGTTCGGCCTCGGAGGGGGCTTCCTGGTAGTGCC