tg0580

Coordinates:2288485-2288718

>r_klactVI6572 2288718 2288485 -78
MFNIKLFATADGNRTDWFILLRIFFFSRPCESFQMIFRFFLLNQFKNLRFKHFLFIRLPLPTSHVWRKEFSFDNIISR

>r_klactVI6572 2288718 2288485 -78
ATGTTTAATATCAAATTGTTCGCTACCGCTGATGGAAATAGGACTGACTGGTTCATCTTGTTGAGAATCTTTTTTTTTAG
TCGACCGTGTGAATCTTTTCAAATGATCTTCCGGTTTTTCTTGCTCAATCAATTTAAGAATCTCAGATTCAAGCATTTTC
TGTTTATTCGCCTGCCACTGCCAACCAGTCATGTTTGGAGAAAGGAGTTTTCTTTCGATAATATAATCAGCAGG


Kluyveromyces lactis Chromosome VI

Sequence spaning coordinates : 2287985 - 2289218 (Additional range around tg0580 is :500nt.)

>Kluyveromyces lactis Chromosome VI TCATTTTCAGGAAAATAATCTGGAAACAGCTTTTAAGCGGTGACCTGCAAAAGATTTCAGTAGGACCTATCTTACCGATA ATCACTGATTGGGAACTTGCTGAAAACTTTGATACAGAATTTACGGAGAAAAGGCTAGACACCAGTATTTATGATAATGG CATAGAGATTAACAACCCTCGTGCAACGAAAGAATCCGCCTTTGCAGGATCTACGGATTATTTTAAGGGGTTTAGTTATG TTGCTAGTCGGAGCTACTTGGAAAGACACTTTTAAAGAAACCATTCCATACTTTACAGCCCTTGCCGACTAAATTTTAAG TTATCTGAACTCATACGATTACTCGGATAACCTTATGTACTATATATAGATATTGGTATGATGATACCACTTAATAACTT CTTATTTAGGGGAAACTATACATATTCTTTAGAGACAATCATTTCAGATAATACCAGTGTCAGAGATCTTTCTGTTTCTG GAGGGGTGTTCAAAAAGTG ATGTTTAATATCAAATTGTTCGCTACCGCTGATGGAAATAGGACTGACTGGTTCATCTTG TTGAGAATCTTTTTTTTTAGTCGACCGTGTGAATCTTTTCAAATGATCTTCCGGTTTTTCTTGCTCAATCAATTTAAGAA TCTCAGATTCAAGCATTTTCTGTTTATTCGCCTGCCACTGCCAACCAGTCATGTTTGGAGAAAGGAGTTTTCTTTCGATA ATATAATCAGCAGG TGAAATTGAATGGGTGTAGTTATTTGCACCATTCCAATTCTCAGCAGCACAATTATCTCTACTTT GTGGTACTAATATATCCTCTAAATCTCCATCCGTCAAATCTAACTCGCCGCATTCTTCCAAAGAACCGCAAATCATTGAG GAATATTTTATCAATTTCCTTTTTGTGAAGCTAACTTTATCCGCCATTCTGGATAATTATTTGGCTATTCGTTGGACTTC TTGCTTCTGTCCAAATCTAATCAATTCATCAATAATAATGAGATCTCAATACTAAATCGACACCTGAATTGATCGTTTGT TCATAGGATATAAAAATAAATCTCAGCAAATTTTATTGGAAATAATTTCAGAGAATCATTCCAATATGCAGAGTATTTAG ACCCTAATAATCGGACAGTGGTGATTTTCCATTCGAGACGTCAAATATTCAATGCGTGTTATTTGTGTCAGCCTGACGGT AACAAGTCCCTAAATGAAGAAAAAAAGGCAATTTT