tg0581

Coordinates:546842-547312

>tg0581 Pyruvoyl-dependent arginine decarboxylase (pdaD/PvlArgDC)
MSWMTPKRAFMGAAAAEGGTKLNAFDNALLKLGIGNVNLVKLSSVIPAHIEWIEKVHDVPIGMLLPTVYAHIESDEPGMT
ISAALGVGISEGNEGGLIYEYSGYCTKEEAEEMVRKMVEEGFAVRGWKLKEFKAVSAEITVKEKPAAVVAAVVMFPY

>tg0581 Pyruvoyl-dependent arginine decarboxylase (pdaD/PvlArgDC)
atgagctggatgactcccaagagagctttcatgggtgcagctgccgcagaggggggaacgaagctcaacgcttttgataa
cgccctcctgaagctgggaataggaaacgttaatctcgtcaagctcagcagcgttatacccgcccacatcgagtggatcg
aaaaggttcacgacgtcccaataggaatgctccttccaacggtatacgcccacatcgagagcgacgaaccggggatgacg
ataagcgccgcccttggtgtcggtataagcgaggggaatgagggcggtcttatctacgagtattccggctactgcacaaa
ggaagaggcagaggaaatggtcaggaagatggtcgaggaaggcttcgctgttcgcggctggaagctcaaggagttcaagg
cggtctcggccgagataacggtcaaagaaaagcccgccgcagtcgttgccgctgttgtcatgttcccctac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 546342 - 547812 (Additional range around tg0581 is :500nt.)

>Thermococcus gammatolerans EJ3 GCACTTCACAATCGGCGCCTTCCTCGCCGGTCTGCTCCTTCACAGCGATCTCGTTGGGACTAGACAGTACGAGAGGCTTG AGACCATATTGAGCGGCGTTACCTACGGTATCTTCGCCCCCATCTTCTTTGCCTGGCGCGGGATGAACTTCAGGGCGGAG GTCACCCTTGCGACGGCTTATTTCTTCCTTGCGATTTATCTCGTCCGCTTCCTGCTGACGGTTGTCCTAACGTGGGACGG AAGGCTCCTCAGCTCGATCGCAAAGGCTACCGGGCTCGTGAGCTTCGGCATCCTCGGGCTGCTTGTTTCGGACCTCGGGA ACTCCTACGGCGTATTAACAGGTGAGCTCTACTCCATATCGGCTTTGACGTCCATTGGAGGCATCTTCCTCGCGGCGACG ATCGGCAGGGGTCTTTCCTTCCTCCGCCGTTCGAGTGGGAAAGGTTTATAAGTCCCGCGATGAGGGAACGGGTAGCTGTA AAGTGAGATGGGTGGTGAAG atgagctggatgactcccaagagagctttcatgggtgcagctgccgcagaggggggaac gaagctcaacgcttttgataacgccctcctgaagctgggaataggaaacgttaatctcgtcaagctcagcagcgttatac ccgcccacatcgagtggatcgaaaaggttcacgacgtcccaataggaatgctccttccaacggtatacgcccacatcgag agcgacgaaccggggatgacgataagcgccgcccttggtgtcggtataagcgaggggaatgagggcggtcttatctacga gtattccggctactgcacaaaggaagaggcagaggaaatggtcaggaagatggtcgaggaaggcttcgctgttcgcggct ggaagctcaaggagttcaaggcggtctcggccgagataacggtcaaagaaaagcccgccgcagtcgttgccgctgttgtc atgttcccctac TAGATCCTCTCCATATCTATGAGGGTGAACTCGTCTGCCTTTCTTTTTTCAAAGGTCATCCTGTACC TTGTTTCCCCCTTTGAGGCCAGAACCTCAACGTAGCCGCTGTTCTCCCCACCCATTACGTTCATCCATACAACGTTGTAG CCCCTCCTCTGCAGGACGTTTTTGAGGACCCCCTTAATTGTCACGCCCGGCTCCAGCCTCTTGCCCTCACTCCTGCCCTT GAGGAACGTCCACAACTCCAGAAACGTCGTTCGGGGATTTGAGTTCTCAACCGGCATCATGAAGAGTATGGATTTTCCAT CCCTCAGGAGAATCCAGTGGGACGATTCAGAAAAGACCGTTACGGTAAGTTCAAGGTTTGGGTCATCCTCGCTTTCTAGA ACGAGCTCACCGACGAGATGAGGAATCCCGTACCTCATCCCCTCTTCTATCTCCCCGACGAGGGATTTGATCCTCTGAAA GAGCTCTTTCCTGACTTTGATTTCATTCATCA