tg0586

Coordinates:550387-551016

>tg0586 hypothetical protein TGAM_0586
MSVPREVLDELDKRIKRLQAVIEIAESVPPSDNRPIPKLQSSFSVYLWMSVAWFIGGFLIIYFLRSRYGGALNSAPTGVS
LAVYAVLALGVVILLVAYYLSRRKEEGEVFDIDERARAARRLLKEFYLPLKKALEGDDEEAVRALADKLLEDPLLARAMD
VLHEGNPKLCAYALYLYVSREKVGGDEIRETLERLDNKPLRRLLSVLVEG

>tg0586 hypothetical protein TGAM_0586
atgagcgttccgagggaagttctggacgagctcgataagaggataaagcgactccaagcagtcatcgagatagccgagag
cgttcctccttcagacaacagacccatcccaaaacttcaatcctcgttctccgtgtacctgtggatgagcgtcgcgtggt
tcatcggaggtttcctcataatctacttccttcgctcccggtacggaggagcccttaacagtgctcccaccggggtttcc
ctggcggtttacgctgtactagctctgggcgtcgtgattctgctcgttgcctactatctctcccggaggaaggaggaagg
ggaagtttttgatatcgatgagagggctagggcggcgaggcgtctcctcaaggagttctacctccccctcaagaaggccc
tagaaggggacgatgaggaagcggttcgtgccctagccgataaactcctcgaagatccgctcttggccagggcaatggac
gttctccatgagggaaatccaaagctctgtgcctacgctctctacctctacgtttccagggagaaggttgggggagatga
aatccgggagacccttgaaaggctggacaacaagcccctccgcaggcttttaagcgtgctggtcgagggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 549887 - 551516 (Additional range around tg0586 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCTTTGCCCTCAACGCCTATCCCGGCACGATCAACGTCCGTCCCGAATCCCTGAGGATGTACGTTGGTGATGTTCTCGC TGAACTTGCGGCGGAGGGCTTTAAGAAAATAGTCCTGCTCAATGGGCACGGTGGGAACGTCTATCCCCTCACCGAGGCCG CCGAAGACGTGGCCGAGCTTTACCCCGACGTTGAGGTTTACTTAATCAACTGGTGGCTCGACTTCAGGGAGGATATTCTC TCAGTCTGCTCCGGCCAGGGGCACGCTGGAGAGGACGAGACATCGGTTATGCTGGCGATACGGCCTGAACTCGTTAACAT GCGTGAAGCTAGGGGGAGGAGAGTCAAGAGAAAAATCAGGGTGATAAAGAAGGACATAGGGAAGGAGGTATTCCCCGACG GCCTCAACGACGATCCCTCCTCCGCGACCGCCGAGAAGGGTGAGAGAATACTCCAGATCGTGTCGGAGAGTATAGCCCGC ATAATCCTTGGTGAGGAGGG atgagcgttccgagggaagttctggacgagctcgataagaggataaagcgactccaagc agtcatcgagatagccgagagcgttcctccttcagacaacagacccatcccaaaacttcaatcctcgttctccgtgtacc tgtggatgagcgtcgcgtggttcatcggaggtttcctcataatctacttccttcgctcccggtacggaggagcccttaac agtgctcccaccggggtttccctggcggtttacgctgtactagctctgggcgtcgtgattctgctcgttgcctactatct ctcccggaggaaggaggaaggggaagtttttgatatcgatgagagggctagggcggcgaggcgtctcctcaaggagttct acctccccctcaagaaggccctagaaggggacgatgaggaagcggttcgtgccctagccgataaactcctcgaagatccg ctcttggccagggcaatggacgttctccatgagggaaatccaaagctctgtgcctacgctctctacctctacgtttccag ggagaaggttgggggagatgaaatccgggagacccttgaaaggctggacaacaagcccctccgcaggcttttaagcgtgc tggtcgagggt TAAAGGATTTAAGTTTCGGTTTCCTATCCTCAACCGCCCTCCCCTCTCACACCCCCGTGAAGGGTGAG CGGGGGGCGGTCGGGGAGGGCACAGCCCCACTTGTTATTTTCTCTCAAAGAACAGTTCCCGGTTCAGCCTCGGTATCATC GCCATTAAGACTGCGATCTCGTTGAGTTCCGTCCTCGTGAGTAATCCTTTGCTCAGAACGCCTATCGCGCCGACCTTTCT CTTGAGTTCGGGGTCGTTAACGAGCTCGCCCATCGCTATGCCAGCTTCAACGCCCTCCTTAAGGATTCTCTCGATTACAA CCGGCGGATACTCAAAGCCCGGCCCGTGACCTATGGTTATCACCCCATCGGGACTAACAATTGCGCAGACCTGAACGTCG AGATAGCCGGTCAACGTTCCCGGGAAGGGGTAGATTCCCGCCTCTATTCCGACGCCGAGATCTGCTCCTGTCTTCTCCAA TGCTTGCTTAGCCCTGTTTATAGCACCCCTT