tg0587

Coordinates:551122-551808

>tg0587 hypothetical protein TGAM_0587
MIAKTNPEQGALSLETGEAKDKTLPPHGYRAKVGDFIYKVFGGSEMGGIMRIAVGSTNPTKVKAVENVMRRIYGDVEVVG
VEVDSGVSDQPIGIEEIARGAINRAKQALEKTGADLGVGIEAGIYPFPGTLTGYLDVQVCAIVSPDGVITIGHGPGFEYP
PVVIERILKEGVEAGIAMGELVNDPELKRKVGAIGVLSKGLLTRTELNEIAVLMAMIPRLNRELFFERK

>tg0587 hypothetical protein TGAM_0587
gtgatagctaagactaacccagaacagggggctttaagcctcgaaacgggcgaagcgaaggataaaacactcccccctca
tgggtatcgggccaaagttggggattttatttataaggtttttggaggctctgaaatggggggtatcatgaggattgcag
ttggctcaactaatcccacgaaggttaaagccgttgagaacgtgatgcggaggatttatggcgacgttgaggtggtcggc
gttgaagtggacagcggcgtttcagaccagccgattggaatcgaggagatagcaaggggtgctataaacagggctaagca
agcattggagaagacaggagcagatctcggcgtcggaatagaggcgggaatctaccccttcccgggaacgttgaccggct
atctcgacgttcaggtctgcgcaattgttagtcccgatggggtgataaccataggtcacgggccgggctttgagtatccg
ccggttgtaatcgagagaatccttaaggagggcgttgaagctggcatagcgatgggcgagctcgttaacgaccccgaact
caagagaaaggtcggcgcgataggcgttctgagcaaaggattactcacgaggacggaactcaacgagatcgcagtcttaa
tggcgatgataccgaggctgaaccgggaactgttctttgagagaaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 550622 - 552308 (Additional range around tg0587 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCGATTCGATGTACTCGTTCTTTATGGTCATGTAGGGGTTGTCCCAGTCCATCCAGATGCCGAGCATCTTGAACTGCTC GGTCATTATCTTCAGGTTGTTGAGGGCGAACTCCTTGCACTTCTTGATGAAGTTGTCGACGCCTATCTCGGTCTCTATGT CCTTCTTGGTTTTGAGCCCGAGGGCCTGCTCGACCTTGACCTCTATCGGCAGGCCGTGCATGTCGAAGCCCGGCTGTCTG CGAACGTTGTAGCCCTGCATGGTCCTGAAGCGGATTATCATGTCCTTGATTATCTTGTTCCAGGCCGTTCCGAGGTGTAT CGCACCGCTCACGTACGGCGGTCCGTCGAGGAAGTAGTACTTCGGGCCGTTCGCCCTGCTGGCCTTGACCTTCTTGTAGG TGTTGTTCTCCTTCCAAAAGGCCTCTATCTTCTCCTCCAGCTTGCCCGGGTTGTATTCCCTAAACTCTGGCTCCTTAATC ATCCCAGAACCCTCCAGAA gtgatagctaagactaacccagaacagggggctttaagcctcgaaacgggcgaagcgaag gataaaacactcccccctcatgggtatcgggccaaagttggggattttatttataaggtttttggaggctctgaaatggg gggtatcatgaggattgcagttggctcaactaatcccacgaaggttaaagccgttgagaacgtgatgcggaggatttatg gcgacgttgaggtggtcggcgttgaagtggacagcggcgtttcagaccagccgattggaatcgaggagatagcaaggggt gctataaacagggctaagcaagcattggagaagacaggagcagatctcggcgtcggaatagaggcgggaatctacccctt cccgggaacgttgaccggctatctcgacgttcaggtctgcgcaattgttagtcccgatggggtgataaccataggtcacg ggccgggctttgagtatccgccggttgtaatcgagagaatccttaaggagggcgttgaagctggcatagcgatgggcgag ctcgttaacgaccccgaactcaagagaaaggtcggcgcgataggcgttctgagcaaaggattactcacgaggacggaact caacgagatcgcagtcttaatggcgatgataccgaggctgaaccgggaactgttctttgagagaaaa TAACAAGTGGGG CTGTGCCCTCCCCGACCGCCCCCCGCTCACCCTTCACGGGGGTGTGAGAGGGGAGGGCGGTTGAGGATAGGAAACCGAAA CTTAAATCCTTTAACCCTCGACCAGCACGCTTAAAAGCCTGCGGAGGGGCTTGTTGTCCAGCCTTTCAAGGGTCTCCCGG ATTTCATCTCCCCCAACCTTCTCCCTGGAAACGTAGAGGTAGAGAGCGTAGGCACAGAGCTTTGGATTTCCCTCATGGAG AACGTCCATTGCCCTGGCCAAGAGCGGATCTTCGAGGAGTTTATCGGCTAGGGCACGAACCGCTTCCTCATCGTCCCCTT CTAGGGCCTTCTTGAGGGGGAGGTAGAACTCCTTGAGGAGACGCCTCGCCGCCCTAGCCCTCTCATCGATATCAAAAACT TCCCCTTCCTCCTTCCTCCGGGAGAGATAGTAGGCAACGAGCAGAATCACGACGCCCAGAGCTAGTACAGCGTAAACCGC CAGGGAAA