tg0601

Coordinates:568370-569266

>tg0601 Maltose transport system permease protein (malF)
MKKSTVAALTLILPGMAAFLFFNIYPILYSIYIAFTNAQMGNFPTHNPSAPPLKFVGLDNFRWALNDPGFRSAFLWTWIF
VATSVTLKVLAGIFLSVLYNSKYVIGKSLYRALLIIPWALPLLFSITVWRFMFDPIFGPVNIILRDFGVSNPPDWINNAT
YGFIALNIIEVWLAYPFMMTVITSALQSVPDILVEAAIIDGANYWQRLTKVVLPIVSKPIAFATILTSAASFQYFLVPFL
YNGSLFEDRFLLLYGYRKAFGASVPHYGRAAAVLFIATLILAVYMYISMKITKLQEGAS

>tg0601 Maltose transport system permease protein (malF)
atgaaaaagagcacagttgcggcgttgacgctgatcctccctggcatggccgctttcctcttcttcaacatatacccgat
actctattcgatttacatcgcgttcacgaacgcccagatgggaaactttccgactcacaatccatcggcaccgcccctga
agttcgtcggtctcgacaacttcagatgggcgctcaacgatcccggcttcaggtcagctttcctctggacgtggatcttc
gtggcgaccagcgttaccctcaaggtccttgcgggcatattcctctccgtcctctacaacagcaaatacgtcatcgggaa
gtccctctaccgggcgctcctcataattccctgggcccttcctctcctgttctcgatcacggtctggcgcttcatgttcg
atccgatattcgggcccgttaacataatcctccgcgattttggagtttcaaatccccctgactggataaacaacgcgacc
tacggcttcatagccctcaacatcatcgaggtctggctggcttaccccttcatgatgacggtgataacctcggcccttca
atcggttccggatatactggttgaggcggccataatagacggcgccaactactggcagaggctcaccaaggttgttctgc
caatcgtgagcaagccgatagccttcgcgaccatactaacgagcgccgcgagcttccagtacttccttgttcccttcctc
tacaacggctccctctttgaggacaggttcctgctcctctacggttaccggaaggcatttggggcgtcggttccccacta
cggcagggctgctgccgttctcttcatagccacgctgatcctggcggtttacatgtacataagcatgaagataaccaaac
tgcaggagggggcgagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 567870 - 569766 (Additional range around tg0601 is :500nt.)

>Thermococcus gammatolerans EJ3 GGCCCGTGGATAATCTCAAAGGTCAAGGAGGCGGGAATAAACTTTGGTGTCGTCCCGCTCCCGCCGATCAACAAGGACGG AAAGACCTACTACCCGAGGCCCTACGCGGGCGTTAAGCTGATCTACGTTACTTCAAACGCTCCGGACGAGAAGATGCAGG CGATATGGGAGTTCCTCAAGTGGTTCTCCACCAGTGAGGACGTTGCCGTAACCCTCGCCTTCCAGAACGGTTACGTTCCC GTTCTCAACAGCGTCGCTAACGAGCCTGACATCACGAGCGATCCTGTGATAAGTGCCTACCTGCAGGCCCTCCAGCATGC ATACCTCATGCCCAAGAGCACCAAGATGGCGGCCGTCTGGGGTCCTGTCGGCCAGGCTATCACGGACTACATCGGCGGCA AGAAGACTCTGGAGCAGGCCCTCAACGATGCCCAGAAGGAAATCCTGAAGGCCCTAAGCAGCTGATCTCTTCTTTTTAAC TTTCTTGCGAGGTGAAAGGG atgaaaaagagcacagttgcggcgttgacgctgatcctccctggcatggccgctttcct cttcttcaacatatacccgatactctattcgatttacatcgcgttcacgaacgcccagatgggaaactttccgactcaca atccatcggcaccgcccctgaagttcgtcggtctcgacaacttcagatgggcgctcaacgatcccggcttcaggtcagct ttcctctggacgtggatcttcgtggcgaccagcgttaccctcaaggtccttgcgggcatattcctctccgtcctctacaa cagcaaatacgtcatcgggaagtccctctaccgggcgctcctcataattccctgggcccttcctctcctgttctcgatca cggtctggcgcttcatgttcgatccgatattcgggcccgttaacataatcctccgcgattttggagtttcaaatccccct gactggataaacaacgcgacctacggcttcatagccctcaacatcatcgaggtctggctggcttaccccttcatgatgac ggtgataacctcggcccttcaatcggttccggatatactggttgaggcggccataatagacggcgccaactactggcaga ggctcaccaaggttgttctgccaatcgtgagcaagccgatagccttcgcgaccatactaacgagcgccgcgagcttccag tacttccttgttcccttcctctacaacggctccctctttgaggacaggttcctgctcctctacggttaccggaaggcatt tggggcgtcggttccccactacggcagggctgctgccgttctcttcatagccacgctgatcctggcggtttacatgtaca taagcatgaagataaccaaactgcaggagggggcgagc TGATGTTCGATTTCCACTTCAGGAACAGAAGGGAGCTTTTT AAGGCCCTCCTCGCAACGGCCCTGGCTATAATCGTCATGGGTATAATTCTCTTTCCCGTGTATTATGTGTTCACGGTCTC ACTTAAGCCCCAAGGAACGCTCGCCTCGACGTCTCTCGACCTCTTACCGGACCAGATGACACTCCAGAACTACAAAGAGG TAATGTTTGGCCACAAGGATGCGACCGTAAAGACCAAGGTCTTCAACATAACTTCCTCAAGGGGCAAGCTCATCGGAACG GAATACACCATAGAGTACATGGACGGCGTGCTCTACGGGAAGTACAGAGGTCTGCCCCCCAGGTTCAATCTCAAGTATAT CTCGCACCTAAAGGTTGAAGGGGCTAACAGAAGCGTCGAAAACGGCCAAGTGCAGTACCTCGGAGGCAAGTTCGTCTCTA TGGATGCGAAGAGAATTATGGTCTCCTTAGCTTCCCTTAGGAGGGAGTACCTATATCT