tg0622

Coordinates:593995-594549

>tg0622 hypothetical protein TGAM_0622
MAQYGIMEKKWVWMLLLGVVFMTLGFAGLMMLPLMTLSSVAVFGAFMLVGGILQVLHGLTKAKDWKSAGVHTLMGLVYVL
AGIFTIENPILASATLTLLLGVSLIVIGTLRMGVAFQNKDVNQWPAMVFSGLLTVLLGLFIVLQWPWSSLWAIGLYVSVD
LIMSGANFVAIALAAKTAGERSSPA

>tg0622 hypothetical protein TGAM_0622
atggctcagtatgggataatggagaaaaaatgggtatggatgctcctgctcggtgttgtgttcatgaccctgggtttcgc
tgggctcatgatgcttccactgatgacgctgagcagtgtggccgtgttcggagcctttatgctagtgggtggaatacttc
aggtgcttcacggtctaacgaaggccaaggactggaagagtgcaggcgttcacacgctcatgggcctggtatacgttttg
gcaggtatctttacaattgaaaacccaatactcgcgagtgctacgctcaccttgctcctaggggtctcgctcatcgtgat
cggaacactcaggatgggcgtggcgttccagaacaaggacgtgaaccagtggcctgcgatggttttctccggcctcctga
cggttctacttggtctcttcatagtgctccagtggccctggtccagcctgtgggctattggcctttatgtctcggtggat
cttataatgagcggtgccaacttcgtggcgatagcgcttgccgcaaaaactgcgggggagagatcctctcccgcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 593495 - 595049 (Additional range around tg0622 is :500nt.)

>Thermococcus gammatolerans EJ3 CGTTGAGGACGTCGAGCGCGCGAGGAGACGTTATCCCAACGCCAAGCTGATGGTCCACCCCGAGTGCGAGCCGGAAGTGC AGGAAAGGGCCGACATAATCGCCTCGACGGGTGGAATGATACGGCACGCGCCGGAGTGGAACGAGTGGGTCGTCTTCACC GAGAGGGAGATGGTCTACCGGCTGAGCAGGCTCTATCCAAACATAAAGTTTTACCCCGCCCGCGAGGACGCAGTCTGCGT TGGAATGAAGGCGATAACGCTCGAAAGCATCTACGAGTCCCTCAGGGATATGAAGTACCGCGTGGAGGTTCCGGAGGAGA TAGCCAAGAAAGCAAAGAGGGCCATCGAGAGAATGCTTGAGATGAGCTAAGCCTTCGGGGCTTCTTTTTTCTGGCTGTTT TGATGAATTTTTAAGTCCATCCGATCGTTAGCGTGAGCTTTCGAAAATCTTTTAAACACAAAATGTAACTAAAAACTGAC AAAACTCTGGAGGTGATAAA atggctcagtatgggataatggagaaaaaatgggtatggatgctcctgctcggtgttgt gttcatgaccctgggtttcgctgggctcatgatgcttccactgatgacgctgagcagtgtggccgtgttcggagccttta tgctagtgggtggaatacttcaggtgcttcacggtctaacgaaggccaaggactggaagagtgcaggcgttcacacgctc atgggcctggtatacgttttggcaggtatctttacaattgaaaacccaatactcgcgagtgctacgctcaccttgctcct aggggtctcgctcatcgtgatcggaacactcaggatgggcgtggcgttccagaacaaggacgtgaaccagtggcctgcga tggttttctccggcctcctgacggttctacttggtctcttcatagtgctccagtggccctggtccagcctgtgggctatt ggcctttatgtctcggtggatcttataatgagcggtgccaacttcgtggcgatagcgcttgccgcaaaaactgcggggga gagatcctctcccgcc TGATCTCATCTTTTTGGCGCCATGTGCCTTACGGTGTAGTGCTCGAGCGTCGCCCCTTTCTCC ACGAACTCGTGGGGCCATATCTTGACGTTGTACATTCTCACGTTGTCGCTTATTATTGCATTGTCACCTATGACCGAGTT CACGATTCTCACGTTGTCCCCTATTTCAACGTGCCTCCCTATTATCGAGTTCATTATCCTCACGTTGTTCCCGAGCTTTA CCCTGTCCATGACGACTGAGTGGAGGATCTCGCAGCTCTTCCCCACCATGGAGTAGTTGTCGATTATGGCGTCCTCCAGG GCAGTTCCTTTCCCTATGGAGATGTGCCTCCCGAGCAGAACCTTTCCCTCAACTAGGAGCTCGCCGCGCTTTATCATTTC CCTTATCCTGCGCCTCAACCTTTCTGACATCTCCGACTTACCCTGCATATACACGTCTCGGGTTATCTCAACGGCCTCCA TGTCCTCGGGGGATAGGTGGTGGAGTAAGTACATCG