tg0632

Coordinates:603592-603918

>tg0632 hypothetical protein TGAM_0632
MVNLDELKVNAQEYLEDADYLYNKGHYNSALNLYFKALVAICDYIILRDTGKLPRNHTERFRILEEKYPDIYDIVDFHFN
NYRKAYLMRATKEWVEVLKNDVHNLYSQL

>tg0632 hypothetical protein TGAM_0632
atggtaaaccttgacgaactcaaggtcaacgctcaggagtaccttgaggacgctgattatctctacaacaaaggccacta
caactcggccctcaacctctacttcaaagccctcgtggcaatctgcgactacataatcctccgcgacacagggaaactcc
cgaggaatcacactgagcgctttaggattctcgaagagaaatatcctgacatctatgacatcgtggacttccacttcaac
aactaccgcaaggcctacctcatgagggctacaaaggaatgggtggaggtgctgaaaaatgacgtccacaacctctactc
tcagctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 603092 - 604418 (Additional range around tg0632 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAGAGGATTTCACCCTGGGAGGAGCCGAGTGAGGAGTTCCCGCTGATTCTAACGACTGTCAGACTGATAAACCACTACA ACACGGGCGAGATGACGCTGAGGAGTCCCTCACTAGTCAAGTTAATGGGCGAACCTAAGGTCATGATCAACGAGAAAGAT GCGAAAAGGCTTGGAATCACCGATGGAGACTGGGTGGATATAGAAACGAGGCGCGGGAGAATAAGGATGCGCGCGAAGGT CGGCGGCGTCCCTGAGGGGCTCGTTGCAATCCCCTTCCACTTCAAGGCGAACCGGATTACCAGTCCGGCCCTGAACAAGG CCGGAACGCCCGAGTTCAAGTTCTCGGCGTGTCGGGTTAAGAAAATGAAGGCCCCATGATATGCTCAGCCTTCTTTTGTT ACCATGATAACATTTTAGTGTTTTTCTTTCTTGATTGTTATCATGCAAACCGCAAAACTTATATACGAGTTTTTTGTTAT CATGATAACGAGGGAACGGC atggtaaaccttgacgaactcaaggtcaacgctcaggagtaccttgaggacgctgatta tctctacaacaaaggccactacaactcggccctcaacctctacttcaaagccctcgtggcaatctgcgactacataatcc tccgcgacacagggaaactcccgaggaatcacactgagcgctttaggattctcgaagagaaatatcctgacatctatgac atcgtggacttccacttcaacaactaccgcaaggcctacctcatgagggctacaaaggaatgggtggaggtgctgaaaaa tgacgtccacaacctctactctcagctc TGAGCCCCTTCAATTTTTTACCCTCCAAGGAACACTCCACGAAACAGTCAA AAACTTCGTAGAGAATCATAGTGAGGTCTTCGACGTTGTCCTCTACGGTTCAACTGTCCTCGGGAAAGAGAAACCCAACG ACCTCGACCTCATGATACTAACGAGGACGAAACTTCCCGCCTTGGAGCTTAGGAATCTCATCCTCGAACTCAAAAGAGAG CTCTCCAAAATACTCACAAATGCCAAACTCGACATCAGGGCCATGAGCCTTGAAGAGCTCTTCGACCCGAACAACCTCGC AAGCTTGGGGGTCATCATAGAGGGATTTTCTCTCACAAAGAACAAATCAATGGCAGAGCTAATGAATGGGAAAGCATATG CTCTCTTCCGTTTCACCCTTGAAGGCCTTCCGCGGAAGGACAGGGTTCGCTTCCAGTACGCGCTCAAGGGCAGGGACATG AAGAGCGGCCTCCTCAAGGAGCTGAACGGTGAACAGTGGGGGGCTTGG