tg0641

Coordinates:610308-611444

>tg0641 hypothetical protein TGAM_0641
MSEFIPLLNFLSRWVLFGTVAWKAYKTRDKGWALLAAALFIGALDIETYILTPLGIEIPQPAYDVASKVPDFYIALLTIW
GTLHLRYEKTNFNHVVYLSLLLIASYVWLFLLAINFFGSNFAVKASFPSLLLGASLIYVSYVLWNHVISRRLLDRLFPIG
LCTVGLLNLTYPIGRPVEWYSTIAFFLAAVGRLLAAIGAFTFVFYPLSEPIKKTKAPEIVQGAYLARDRKEVQKILPNFF
ENDMIAVTRLSPVEIAGKFTPASMVFWITKAKEGQVSDNPKVIAISPAKLGILQDLIIREIERGYRIVYVDAFEYLVVEV
GFQVAFKFLLSVRDFVLSNGGTLVLVANPETLREQEWKLVLREFTPLKSLKKAEKNPKE

>tg0641 hypothetical protein TGAM_0641
ATGTCCGAGTTCATCCCTCTCCTGAACTTCCTTTCAAGGTGGGTGCTCTTCGGAACGGTCGCATGGAAGGCCTACAAAAC
CCGGGACAAGGGCTGGGCCCTCCTCGCGGCGGCACTTTTCATCGGGGCCCTCGACATAGAGACGTACATACTCACCCCCC
TCGGAATAGAGATTCCCCAGCCCGCTTACGATGTCGCCTCCAAAGTGCCCGACTTCTACATAGCCCTGCTAACTATATGG
GGGACGCTGCACCTCAGGTACGAAAAAACGAACTTTAATCACGTGGTTTACCTCTCCCTCCTCCTCATTGCCTCCTACGT
CTGGCTCTTCCTCCTCGCGATAAACTTCTTTGGAAGCAACTTCGCGGTCAAGGCCAGCTTTCCTTCCCTCCTCCTTGGGG
CATCCCTGATATACGTCAGTTACGTTCTCTGGAACCACGTTATTTCCAGAAGACTTCTCGACAGACTCTTTCCGATTGGC
CTCTGCACAGTGGGCCTGCTGAACCTGACGTATCCCATCGGGAGGCCCGTTGAGTGGTACTCCACCATTGCCTTCTTCCT
TGCGGCAGTTGGAAGGCTTCTTGCGGCCATAGGAGCCTTTACATTCGTGTTCTATCCACTGTCTGAGCCAATTAAGAAAA
CCAAAGCTCCCGAGATTGTCCAAGGAGCGTACCTCGCCAGAGACAGGAAGGAAGTCCAGAAAATCCTTCCTAATTTCTTT
GAGAACGACATGATAGCCGTTACGAGACTTTCACCGGTCGAAATTGCTGGAAAGTTTACACCCGCTTCAATGGTGTTCTG
GATAACGAAGGCGAAGGAGGGGCAGGTCTCCGATAACCCCAAGGTAATAGCGATCTCGCCAGCAAAGCTGGGCATACTCC
AAGACCTGATCATCAGGGAGATCGAGAGGGGCTACCGGATAGTTTACGTTGACGCCTTTGAGTACCTTGTGGTAGAGGTT
GGCTTCCAAGTGGCATTTAAATTCCTGCTTTCGGTGAGGGACTTCGTGCTGTCCAACGGTGGTACCCTCGTCCTCGTTGC
GAACCCTGAAACCCTGAGGGAACAGGAATGGAAGCTCGTGCTGAGGGAGTTCACACCACTAAAAAGCCTGAAGAAAGCAG
AGAAAAATCCAAAGGAG


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 609808 - 611944 (Additional range around tg0641 is :500nt.)

>Thermococcus gammatolerans EJ3 AAATAGGGGAGGGAACCGTCGTCAGGAGCGGGGCCTACATAATCGGCCCAGTAAAGATCGGGAGGAACTCCCGGGTAGGG CCTAACTGCTTCATAAGACCCTACACGAGCATAGGTGACAACTGCCACATTGGTAACGCCGTTGAAGTCAAAAACTCCAT CATAATGGACAACAGCAACGCACCCCACCTCAACTACGTCGGCGACTCGATAATCGGGGAGAACGTTAACCTCGGGGCGG GGACGATAACCGCCAACCTGAGGCACGACAGGACTAACATCAAGGTCGAGATCAAGGGCAAACTAGAGGACAGCGGCAGA CACAAGCTCGGGGCCATAATCGGGCACGGGGTGAAGACTGGAATAAACGTCAGCATCTACCCCGGCAGGAAGATAGGGAG TCACTCCCTCATAGGGCCCGGGGTCGTCGTCGATAGGAACGTTCCCCCTGGAACGATGGTTCTCCTCAGGCAGGAAAAGG TCGAGAAAAGGGTGAGATG ATGTCCGAGTTCATCCCTCTCCTGAACTTCCTTTCAAGGTGGGTGCTCTTCGGAACGGTC GCATGGAAGGCCTACAAAACCCGGGACAAGGGCTGGGCCCTCCTCGCGGCGGCACTTTTCATCGGGGCCCTCGACATAGA GACGTACATACTCACCCCCCTCGGAATAGAGATTCCCCAGCCCGCTTACGATGTCGCCTCCAAAGTGCCCGACTTCTACA TAGCCCTGCTAACTATATGGGGGACGCTGCACCTCAGGTACGAAAAAACGAACTTTAATCACGTGGTTTACCTCTCCCTC CTCCTCATTGCCTCCTACGTCTGGCTCTTCCTCCTCGCGATAAACTTCTTTGGAAGCAACTTCGCGGTCAAGGCCAGCTT TCCTTCCCTCCTCCTTGGGGCATCCCTGATATACGTCAGTTACGTTCTCTGGAACCACGTTATTTCCAGAAGACTTCTCG ACAGACTCTTTCCGATTGGCCTCTGCACAGTGGGCCTGCTGAACCTGACGTATCCCATCGGGAGGCCCGTTGAGTGGTAC TCCACCATTGCCTTCTTCCTTGCGGCAGTTGGAAGGCTTCTTGCGGCCATAGGAGCCTTTACATTCGTGTTCTATCCACT GTCTGAGCCAATTAAGAAAACCAAAGCTCCCGAGATTGTCCAAGGAGCGTACCTCGCCAGAGACAGGAAGGAAGTCCAGA AAATCCTTCCTAATTTCTTTGAGAACGACATGATAGCCGTTACGAGACTTTCACCGGTCGAAATTGCTGGAAAGTTTACA CCCGCTTCAATGGTGTTCTGGATAACGAAGGCGAAGGAGGGGCAGGTCTCCGATAACCCCAAGGTAATAGCGATCTCGCC AGCAAAGCTGGGCATACTCCAAGACCTGATCATCAGGGAGATCGAGAGGGGCTACCGGATAGTTTACGTTGACGCCTTTG AGTACCTTGTGGTAGAGGTTGGCTTCCAAGTGGCATTTAAATTCCTGCTTTCGGTGAGGGACTTCGTGCTGTCCAACGGT GGTACCCTCGTCCTCGTTGCGAACCCTGAAACCCTGAGGGAACAGGAATGGAAGCTCGTGCTGAGGGAGTTCACACCACT AAAAAGCCTGAAGAAAGCAGAGAAAAATCCAAAGGAG TGACTACTTCCCCTCCATCGACTCCCGGAGGAAGTCTTTCGC CTCGTCGCTGAACTTTGATAGGGGAACCTCCTCCCCGAACTTATCGTACACCTTACCATCGCGGAAGTTTATCTCAAAGA TCTCGTACCTCTCCTCACTTTTCTCGTGGAGCTTTATTCCGTGACCCCTGAGATGAGACTCAAGGTTGTCGATATCAACG TACTTACCGCACTTTTCGCACCTGTAAAACTGCCAGAAAACATAATCCTGGCCGATTACAGCGTTCTCCTTTATGTGCTC AATGAGCCTGCCGCCGAGGTACTCATAGACGTCCTCCTGCTTGAGGGAGTTTCCGTTTTCGACGACTTTGAAACCGCTCC AGACGATGTGGTCATGTATATCACTCAGAGTTGCCCTCGCGTACTTGTACGTCATGACGAAGGCCCCATTGTGAACCGCG AAGACACCCTTCTCAGGAACCGCTATGATCACGATGCCCCTCTCGTTTAAGCCATCGG