tg0652

Coordinates:623332-623688

>tg0652 hypothetical protein TGAM_0652
MRSKSLAQLVLFILIAAFWYKIAWPVMTKEALALGAVGGLLIHWAFTNKGSRAVALIEPGTSGWRVMMYDMMFVSFLTAL
AQQAGDVSALLDALKTSVQNLALLLALAGGIGVDYSVGG

>tg0652 hypothetical protein TGAM_0652
atgaggtcaaaaagcctcgctcagctggttctcttcatcctcatcgcagcattctggtacaagattgcatggccagtgat
gacgaaggaggctctcgcactaggcgcggtcggtgggctgttgattcattgggctttcacgaacaaggggagcagggcag
tagcactcatcgagcctggtacgtcaggctggagggtcatgatgtatgatatgatgttcgtcagcttcttgacggcattg
gctcagcaggctggagatgtcagcgctcttctcgacgcgctcaagacctcggtgcagaacctcgcgcttctcctcgccct
cgcgggcgggattggggttgactactcggttgggggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 622832 - 624188 (Additional range around tg0652 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTGAATGGTACCGGTGCTTTTGTATGGGCTTTTAGCATTGATAGGGAAACACATCGCATGATTAAAGAGCTCTCTAAGA GCCTTGGTCTTAACAATGACTCGGCTGTTGTCAGGATGGCAGTAAGAAGGCTCTACAAGGAGATAAAGGCTTGAGTTCCT TCAATCTTTTATAATTGCTATAAACTCGCTATAAAGCCCCTTTCTAATATTCTTAAATATCTTTGCCGTACTCTCTATTT TGGGACACCTTGGGCCTTCCTCCGCTCAAATCAGTTCTGTAAAATCATCATTGCCTGCACGGAGGCGGTAGTATGGACTC GCTTGAGAAGCTCGAAAGAGAGGTTGAGTTCTGGAGCAAGTACAATTCTCAGCTTTCAGAGATGCTCGAAGGACTCCAGA AGGAGAAAGCCCGCGCAGTGAGGATCCTTCAGCAGAAGCGGACCGAGCTCGCGAGGCTGAAGCAGGTCAGAATGGCAAAA GCCCGAAAGGTGACGGCAGT atgaggtcaaaaagcctcgctcagctggttctcttcatcctcatcgcagcattctggta caagattgcatggccagtgatgacgaaggaggctctcgcactaggcgcggtcggtgggctgttgattcattgggctttca cgaacaaggggagcagggcagtagcactcatcgagcctggtacgtcaggctggagggtcatgatgtatgatatgatgttc gtcagcttcttgacggcattggctcagcaggctggagatgtcagcgctcttctcgacgcgctcaagacctcggtgcagaa cctcgcgcttctcctcgccctcgcgggcgggattggggttgactactcggttgggggg TGAAAAATGGACGTTCTCGGA CTGGTTCTCGCGTTTGGATTGATTGGGCTCGGTGTTGTCATGCTTGGGCTTAGCATTGACACGTGGGCGCTCTCAAGGAG GTGGTCTAAGTGAAACGGTTCGGGTTGGTTCTGGCTTTGTTGGTGCTGTTCGGAACGCTAACAGTAGGGACAGTGCGGGC AGAGGGAACTTATTCGGTTGTTGCTTATCTGAGTACTCTTCATGAGGTAAATTTGGACAATGCGTTGTCAGTGCTCGGTG GAACGAGAGAGGGGGATTGTGTAGTTGCATATAAGAATGTCAATGGATTGGAGCATCCTTTTGAGATCAGAGTGTATCAA TCGAGGGTGGAGGTGTGGTATTCGGGGCAGAAGGCTGAGATTTTGAAGGTGTTGAGGGTTGTGGATCCATCGGGCGTTGT AAGTGCTGGCGATGTTACAGTGAATGATTTGTATATTGTTCATGTGTTGTTGAATACGTACAATGATTTGGTTTCGGG