tg0658

Coordinates:629465-629695

>tg0658 hypothetical protein TGAM_0658
MDVNSAVTQLQDLAHTHPYLALAIILFLLSFLSKNKVLDYLLWFLAALALLKEFSLFGTLVEFLKGIPEMLKQIGGV

>tg0658 hypothetical protein TGAM_0658
atggacgttaattcagcagtcactcaactccaggatcttgcacacactcacccctacctcgccctcgcaataatcctctt
cctgctttcattcctctcaaagaataaggtcctcgactacctactctggttcctcgcggccctcgcgctcctgaaggagt
tttcgttgtttgggactttggttgagttcctcaagggcattcctgaaatgttgaaacagattggaggtgtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 628965 - 630195 (Additional range around tg0658 is :500nt.)

>Thermococcus gammatolerans EJ3 CACTTACATTACACTACCAGAAACAGGGGATAATGAGCTCTTGCTTTGGATTTGGTTGGGAGCCACTATCGCCACAAAGG GACAGTATCTATCTTCTGCCTTAACCATTCCAGCACTAACGCGGCTTGCTGGAATACTACTAAAACTCTGAGGTGACTCG CAATGCTCGGCAGGATTGCAGCGGCCCTCATCGCTTACCTCCTCTGCATTTTCAAGTTCCAGGACAGCATGGTTACAGTG GGCCAGCTTTTTGGCCTCACGGGATTTTGGGCGCTCTTCATTCCTTCGGCCCTCATTGGCCTGAGCGTTTACAGGATTGC AGACTTGGACCATTGGGGCCTGTGGGACGCGGCCAGCTTCCTCGTGATTGGGAGCATAGCAATGCTTGCAATGACTGGCA ATCCTGAGGCGACGATGTACGAGCTCATCAAAGGCGTCGTGAGCTTTTCAGTTGCTGCAATACTCGGTGCAAGAGCCGCA ATCACAGGAGGGAGGCACTG atggacgttaattcagcagtcactcaactccaggatcttgcacacactcacccctacct cgccctcgcaataatcctcttcctgctttcattcctctcaaagaataaggtcctcgactacctactctggttcctcgcgg ccctcgcgctcctgaaggagttttcgttgtttgggactttggttgagttcctcaagggcattcctgaaatgttgaaacag attggaggtgtt TGAAGAATGCGGAAGAAGGAAAGGCAGCTCATAACCCTCGGGTTGGTGGTACTCTTCGCGGCCATAG CTTGGTGGGCTTACAACCAGTACGGAGCCGACACGGGCGTCCTCCTGAACCTTGACAATCAGAGCAACAGCACAGAAACC TACCAGCTGGCTATCTCTGACCTCTCCGCGAGTGTTGACCAGTCAACTGGCCACGTGCTGGTTAGCTTCAAGCTCGCGAA TGAAGAGCACTTCAACATCAGCAGCGTTGAGGTCCTCTATGCACTCAACGTCGCCGATCCCAACAACGCTACCTTTAGCG CTCTGGACGTCACTTCCGAGAACGGCACTTACAAGGCCGAGATTCCGGCCAGTTTCGGCGATACCGTCTACTACAAGGTC AAGGTCGTCTACGACACCGGCAAGGAGCTCGTGACCGACGTCCACACCATAACCGTCGTTGACACTACTGAGCCGACCCT GAGTTCTGTCAGCATTGACTACAACAACACCG